KEGG   Nicotiana tomentosiformis: 104108149Help
Entry
104108149         CDS       T05025                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH11, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:nto00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104108149
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nto03041]
    104108149
Enzymes [BR:nto01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     104108149
Spliceosome [BR:nto03041]
 Complex C
  Other components
   Step II factors
    104108149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C HA2 IBR DEAD OB_NTP_bind zf-C3HC4_2 zf-RING_UBOX AAA_22 KH_1 zf-C3HC4 AAA_30 Helicase_RecD ABC_tran SLS AAA_29 DUF2075
Motif
Other DBs
NCBI-GeneID: 104108149
NCBI-ProteinID: XP_009615427
Position
Unknown
AA seq 1725 aa AA seqDB search
MQRRISPSPAVNQPRYGFHRNQPMSYRFDRPPEKPIQKPPNFIVQLCSTHRVLTRPQLNS
LISKLPFTPQNSFVFSSGFVVGTLLYEQWNQALDVTVELWKLKLKSEHFYTPFVKENIEV
SSDKEELNNSLKGVFLDHLYGILDGVLVQIWEQKLGFLMNEIDGVSSLLRKHNRIGVYGE
LCKKRKGLEAERDLIKLRIDEFKNGIKCIIQYLEEGGKGFVENEEGFRVLKFGGEEFDWD
RIHCLMMRECRRLDDGLPIFAFRQQILKQIHCQQVTVLVGETGSGKSTQLVQFLADSGIA
GNGSMICTQPRKLAANSLARRVREESQGCYDDNSVTCNPSYSSCQQFDSKIIFMTDHCLL
QHYMGDKTLSKISCIIVDEAHERSLNTDLLLALIKNLLHRRFDLRLIIMSATVDADQLAD
YFFGCGTFHVAGRTFPVDIKYVPCESDVHPAVGAIASYVHDVIKMVTEIHRTEGEGAILA
FLTSQSEVEWACDKFQAPLAIVLPLHGKLTYDDQNRVFLFYPGRRKVIFTTNLAETSLTI
PGVKYVVDSGVVKESRFEPGTGMNVLRICSVSQSSANQRAGRAGRTEPGKCYRLYSQSDF
EGMPCHQEPEIRKVHLGVAVLRILALGIKNVQDFDFVDAPSPKAIEMATRNLVQLGAVTQ
RDDDTYVLTAEGRKLVKLGIEPRLGKMILGCFDQRMGREGVVLAAVMANSSSIFCRVGSE
GDKLKSDRLKVQFCHPNGDLFTLLSVYREWEAVPREKKNSWCWDNSINAKSMRRCQETVQ
ELEACLQNELNMIIASYWQWDPQVYTKHDEVLQSIILSSLAENVAMYSGYDQLGYEVALT
GKCVQLHPACSLLNFAQRPRWVVFGQVLASTYEYLVCVTSFEFSSLYSLNPVPLFDFLKM
DAQKLEKKVLTGFGVMLLKRFCGKSNCNINNLVTSIRTTYVDERIGIQVNVDDNEVLLYA
SSRDMKSVTCCVNDALEYESKLLQNECLEKCLFSGGSAASASIALFGAGAMIKHLELEKR
CLTVDIFHSNGNAIDDKELLMFLEKFTSGSICAVYKSSGMGQDSEENKWGRVTFLTPDAA
KQAAFLDQVEFNGGFLKVVSSRSSMHGSDQKMFRSALRAKVQWPRKYSRGVAFLKCHTSD
VAFMINDFSDLMIGERIIRCEPSNKYPDNLVISGIDKEISEAEILEVLRASTNRRVLDLF
LVRGTAVEDPPVATCEEALRKVISPFMPNRIPYVNSVRVQVFQPEPKDAYTRAAITFDGS
LHLEAAKALEQIDGKVLPGCLSWQKIRCQQLFHSSVSCPAPVYHVIRNQLDSLLASLRRR
NGVECNLVRNDNGSYRVKISAIATKVVAEMRRPLEQLMKGKIVDHVDITPTVVQLLFSRE
GTNIMNRIQRETGTYILFDKHNLLVRIFGSSDNVDRAQQRLIDSLLALHESKQLEVHLRG
QHLPPDLMKRVVQTFGPDLNGLKEKVPGAEFSLNTKRHCICINGSKDLKQKVEDLICEIS
QRSGPPTQTMGDEADCPVCLCELEDPYRLEACAHLFCRSCLLEQCESAIKSREGFPVCCM
RQGCREPILLADLKSLLSSDKLEELFRASLGAFVAANGGTYRFCPSPDCPSIYRVADPGM
VGEPFVCGACFVETCTRCHLEYHPYLSCEMYQEFKNDPDSSLKEWSKGKENVKKCPVCSF
TIEKIDGCNHIECRCGKHVCWVCLEFFDSSENCYGHLRNIHLSIT
NT seq 5178 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagacgaatttctccttcaccggcggtgaaccaaccccgttatgggtttcaccgg
aatcagcccatgagttaccggttcgaccggccaccggaaaaaccgatacaaaaaccgccc
aattttatagtccaactctgttcaactcacagggttctcaccaggccacaactaaactct
ctaatttcaaaattaccattcactcctcaaaactcctttgtgttttcctccggtttcgtc
gtcggaaccctactgtatgagcagtggaatcaagcgttagacgtgacggttgaattatgg
aagctaaagttaaaaagtgagcatttttataccccatttgttaaagaaaatattgaggtt
tcatctgataaagaggaattgaataatagtttaaagggtgtttttttagaccatttgtat
gggattcttgatggggttttagtgcaaatatgggagcaaaagttgggctttttaatgaat
gaaattgatggggtttcgagtttgttaaggaaacataataggattggagtttatggtgag
ttgtgtaagaaaaggaagggtcttgaagctgagagggatttgattaaattaaggattgat
gaatttaagaatggaattaaatgtattattcaatatttagaggaggggggaaagggtttt
gttgagaatgaggagggttttagggtgttaaaatttggcggggaagaatttgattgggat
agaattcattgtttgatgatgagagaatgtagaaggcttgatgatggcttacctattttt
gctttcaggcagcagattcttaagcaaattcattgccaacaggtgacggttttggttgga
gagactggatcaggaaagagtacacaattagtgcagttccttgctgattcaggaatagct
ggcaatggttctatgatttgcactcagcctcggaaacttgctgccaactctttagcaagg
agggttagagaagaaagccaggggtgttatgatgataattcagttacctgcaatccatca
tattcgtcttgtcaacagtttgattcaaagataatttttatgacagatcactgcctactg
cagcactatatgggtgacaagactttgtccaagatttcatgtatcatagtcgatgaggca
catgaaagaagcctaaacactgatcttcttttagcattgataaagaacctacttcatcgg
aggtttgatctgaggcttattattatgtctgccacagttgatgcagaccagcttgcagat
tacttctttggttgtggaactttccatgtggcgggtagaacttttccggttgatattaag
tatgttccctgtgaatctgatgtccatcctgctgtaggtgcaattgcctcttatgtccac
gatgttatcaagatggtgaccgagatacatagaacggagggagagggcgctattctagcc
ttcttgacatctcagagtgaagttgagtgggcttgtgacaagtttcaagcacctctggcc
attgttttacctttacatggcaaattaacttatgatgaccaaaaccgagtgtttctcttc
tatccagggaggagaaaggtaatattcaccacaaatcttgccgagacatcactgacaatt
cccggtgtcaaatatgttgttgattctggtgtggttaaagaaagcaggtttgaacctggc
accggcatgaatgttctcaggatatgcagtgtgagccaaagttccgctaatcagagagct
ggtcgtgccgggagaactgaacctggaaagtgttacaggctgtactctcaaagtgatttt
gagggaatgccttgtcatcaggaacctgaaattcgcaaagttcatcttggtgttgcagtg
ctgaggattcttgcattaggtatcaagaatgtgcaagattttgattttgttgatgcacct
agccccaaagctatcgagatggccacccgaaatctggttcaactaggagctgttacacaa
agagatgatgatacatatgtattaactgcagaaggacgaaaactggtcaagttgggtatt
gaacctaggttgggcaaaatgatcctcggttgctttgatcaacgtatgggtagagaaggt
gttgtgcttgctgctgtcatggcaaattccagcagcattttctgtagggttggttctgaa
ggagacaagctaaaatctgatcgccttaaggtgcaattttgccatccaaatggtgacctc
tttactttattatctgtttacagggaatgggaggctgtgcctagggaaaagaagaatagc
tggtgttgggataatagtatcaatgccaaatccatgaggagatgccaggagactgtgcag
gaactggaagcctgtcttcaaaacgaactaaatatgatcattgccagttactggcaatgg
gatcctcaagtttataccaagcatgacgaagttttgcagagtataattctttcttccctt
gcggaaaatgttgctatgtactcaggttatgatcagcttggttatgaggttgcactaact
gggaagtgtgtccaactacatcctgcctgttcgcttctgaattttgcccaacggccgcgt
tgggtagttttcgggcaagtccttgcatcaacttatgaatatctggtctgtgttacttca
tttgagttcagttctctttatagcctcaatcctgttcctttgtttgattttctgaagatg
gatgcccaaaagctagaaaagaaggttttgacaggcttcggagtcatgctactcaaaaga
ttctgtggaaaatctaactgtaacattaataatcttgtcacgagcatcagaactacttat
gtggatgaaaggataggcattcaagtcaatgttgatgacaatgaggttcttttatatgct
tcttcaagagacatgaagagtgttacctgctgtgtaaatgatgccctagaatatgaaagt
aagttgttgcagaacgaatgtttagagaaatgcctattcagtggaggttcggcggcttca
gcttctattgccctctttggagctggtgctatgataaagcatttggagcttgagaagaga
tgtttgactgtggacatatttcattcaaatggaaatgcgattgatgataaggaattgctg
atgtttctggagaaattcacgtctggtagtatttgtgcggtgtataagtcctctgggatg
ggccaggacagcgaggagaacaagtggggcagagtgacatttcttacccctgatgctgca
aaacaagctgcattcttagatcaagtggaattcaatggtggctttctgaaagtagtttcg
tctaggagcagcatgcatggcagtgatcaaaagatgttccggtcagctctcagagctaaa
gtccaatggcctcgtaaatacagtagaggagtagcttttttgaaatgccacacaagtgat
gttgcatttatgataaatgacttctctgacctgatgattggtgaaagaattatccgttgt
gagccaagcaataagtaccctgacaacttggtcatttctggaattgataaggagatttct
gaggcagagatactcgaggtgttgagggcatcaacaaataggagagttctggatttgttc
ttggtgagaggaactgctgtagaagatcctccagtagctacttgtgaagaagcacttagg
aaagtaatatctcccttcatgcctaataggattccatatgttaactctgttcgcgtccag
gtcttccagccggaaccaaaggatgcttacacaagagcagctatcacttttgacggaagt
cttcatcttgaagcagccaaggctttggagcaaattgatggcaaggtattgcccggatgc
ctttcctggcagaaaataagatgtcagcaactatttcacagctctgtttcctgtcctgca
ccagtttatcatgttatcaggaaccagctggattccttacttgctagcctccgacgaaga
aacggcgtggaatgcaacctcgtgagaaatgataacggttcctatagagttaagatatct
gccattgctacaaaagttgtggcagagatgagaaggccattggagcaacttatgaaaggc
aagattgtagatcacgtggacattactccaacagttgttcaacttctcttctctcgcgaa
ggaactaacattatgaacaggattcagcgggagaccggaacctatattctttttgacaag
cataacctacttgtacgaatctttggctcttcagataatgttgatagggcgcagcagaga
ttaatagattcccttctggcgctacatgaaagcaagcaacttgaagttcatcttcgtgga
caacatttgcctcctgacctgatgaaaagagttgttcagacgtttggaccagatcttaat
ggccttaaagaaaaggtgcctggggcagaattctctctgaacacaaagcgccattgcatc
tgtatcaatggtagtaaagacttgaagcaaaaagttgaggacttaatctgtgaaatttct
caaagaagcggtccaccaactcaaacgatgggagatgaggccgactgtcctgtttgcttg
tgtgaactggaggatccttatagacttgaagcttgtgctcatttattctgtcggtcatgc
ttgctagagcaatgtgagtccgcgatcaaaagccgggaaggtttccccgtctgctgtatg
cgtcaaggttgtagggaacccattttgcttgctgatttgaagtcgctattgtcgagtgac
aagttggaggaacttttcagggcgtcattgggggcttttgtggcagccaatgggggtacc
taccgcttttgcccctcacccgactgcccttcaatttatcgtgttgcggatcctggtatg
gttggtgaaccttttgtctgtggtgcatgctttgtggagacgtgtactagatgccacctc
gagtatcatccatacctttcatgtgagatgtaccaggagtttaaaaatgaccccgattcc
tctctaaaggaatggtccaagggaaaagagaatgtcaagaaatgtccagtttgcagcttt
acaattgagaagatagatggctgcaatcatatcgagtgtaggtgcgggaaacatgtttgc
tgggtttgtttggaattcttcgacagcagtgagaattgctatggccatttgaggaatatt
cacctgtccattacatga

DBGET integrated database retrieval system