KEGG   Nicotiana tomentosiformis: 104109114Help
Entry
104109114         CDS       T05025                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:nto00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104109114
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nto03041]
    104109114
Enzymes [BR:nto01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     104109114
Spliceosome [BR:nto03041]
 Complex C
  Other components
   Step II factors
    104109114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 ABC_tran DUF2075 AAA_19 AAA_30 AAA_33 T2SSE AAA_14 ATPase_2 Helicase_RecD FtsK_SpoIIIE AAA_29 SRP54 AAA_16 Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 104109114
NCBI-ProteinID: XP_009616612
Position
Unknown
AA seq 700 aa AA seqDB search
MADLPIVRFEEKIIETVEKNPVVVVIGETGSGKSTQLSQMLYKRGYAKSGMIAVTQPRRV
AAVSVSRRVAQEQNVRLGEEVGYAIRFEDRTSEKTHIKYLTDGVLLRESLFNPELNQYSV
IILDEAHERSLNTDILLGLMKRLIKWRHSNLKVLITSATLDGGKVSRFFSDCPVLTVPGE
LFPVEIVHISERPKNYVEASLKTAIDIHVREPEGDILIFLTGQDDIEKLVMKLEKKIQSL
DEGSCLDALILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDSGY
VKQRQYNPSTGMYSLEVVQISKVQAKQRAGRAGRTRPGKCYRLYPSMVYHDDFLDATVPE
IQRSSLAGTVLYLKSLDLADMDILKFDFLDSPSIESLEDALKQLYLVDAIDENGSITSLG
RKMAELPLEPSLSRTLLEANELDCLSQALTVVSMLSAETTLLPAPSKISEKKRKHTPSNL
PDGAGLGDHIQLLQIYEQWYQTDYNIDWCKENNLQVRGMVFVRDVRKQLSQIMQKIAKGS
LDVQTSKRRRDSPQEYRILRKALCIGYANQLAERSIRHNGYRPLGFKSELVQVHPSSVLK
ADEDGMLPNYVVYHELIVTSRPFMRNVCAVEMRWVAPILAKLEKLNVFKLSGGSSQPDKQ
IQEVTLNVEKKEIATIQSPEDRDSRIQAARERFLARKGQK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggccgatttacctatagttcgatttgaggagaaaatcatagaaacagtggagaaaaac
cctgtagtggtagtcattggtgagaccggttctggtaaaagtacacaactttcacaaatg
ctttataaaagagggtatgctaaatctggaatgatcgctgttactcagcctcgccgtgtt
gctgcagtttctgtttctagacgagttgcacaggagcaaaatgttcgacttggagaggaa
gtcggttatgccataagattcgaagatagaacttcggagaaaacacatatcaaatatctt
acggatggagtgctcctccgcgagagtctttttaatccggagctgaatcaatattccgtc
atcatattggatgaagcacatgagaggagtttgaacacggatatattgcttggtttaatg
aaaagattaatcaaatggcgtcactcaaacttgaaagttttgatcacatcagccactctt
gatggtggaaaggtatctaggttcttctccgactgtcccgtccttaccgtaccaggcgag
ttatttcccgtggaaatagtacacatctcagagcgccctaaaaactatgtggaggcttct
ctaaaaacagctattgatattcacgtacgggagccagaaggggacattttaatatttttg
acagggcaggatgacatagagaagttggtaatgaagttggagaagaaaattcaaagctta
gatgaaggttcttgtctggatgccttaatccttcctcttcatggatccttgccacccgag
atgcaggtgcgtgttttcagtcctccacctccaaattgtaggcggtttattgtttctaca
aatattgctgaaacgtctttgactgttgatggtgtcgtgtatgtcattgactcggggtat
gtgaagcaacggcaatataacccatcaactggcatgtactctttggaggttgttcagatt
agcaaggtgcaggcaaagcagcgtgcaggacgtgctggaaggacacgtcctggaaagtgt
tatcgtttatatccctctatggtttaccatgatgattttttggatgccaccgttcctgaa
atacaaaggtcctcattggctggaactgtactttatttgaagtcgttagatctcgccgat
atggatattctcaaatttgattttctcgactctccttccatcgagtctttagaggatgcc
ttgaagcaattatatttagtcgatgcaattgatgaaaatggttcaatcacaagccttgga
cgaaagatggctgagcttccactggaaccttctctttccaggaccttactagaggcaaat
gagttggattgcttgtcccaagcattgacagttgtttccatgttgtctgctgagaccacg
ctgcttcctgccccaagtaagatctctgagaagaagaggaagcacactccttcgaacctt
cctgatggtgctggcttgggtgatcacatccagctactccaaatttatgagcaatggtat
cagactgactacaacatagactggtgtaaagagaacaacttacaggtccgcgggatggtg
ttcgtgagagatgtcaggaaacagttatctcaaataatgcaaaaaattgctaaaggctca
ttagatgtccaaacaagcaaaagacggagagacagcccacaggagtatagaatattgagg
aaagcattgtgcattggttacgcaaatcagcttgctgagcggagcattcgacataacggg
tatcggcctcttggtttcaagtctgaactcgtacaggtccatccatcttctgtgctaaaa
gcagatgaggatgggatgcttccaaactatgtcgtctatcatgaattaatagttacttca
cgcccatttatgcgtaatgtatgtgcagttgagatgcgatgggttgcaccaatcttagcg
aagcttgagaaactaaatgtcttcaaactgagtgggggatctagtcagcctgataagcaa
attcaagaagtaactttaaacgtggaaaagaaagaaattgctactattcagtcacctgaa
gaccgtgacagcaggatacaagctgctcgggaaagatttctagctcggaaaggtcagaag
tag

DBGET integrated database retrieval system