KEGG   Nicotiana tomentosiformis: 104111770Help
Entry
104111770         CDS       T05025                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00450  Selenocompound metabolism
nto00970  Aminoacyl-tRNA biosynthesis
nto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    104111770
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104111770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nto01007]
    104111770
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nto03016]
    104111770
Enzymes [BR:nto01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     104111770
Amino acid related enzymes [BR:nto01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   104111770
Transfer RNA biogenesis [BR:nto03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    104111770
 Prokaryotic type
   Other AARSs
    104111770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 Viral_protease CEP63 TMEM214
Motif
Other DBs
NCBI-GeneID: 104111770
NCBI-ProteinID: XP_009619836
Position
Unknown
AA seq 806 aa AA seqDB search
MGENCKTIPKLPIPGKRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNAIY
MCGTDEYGTATETKALEENCTPKQICDKYHAIHKEVYKWFDISFDEFGRTSTPQQTEVCQ
AIFKNLFENNWLSENTMQQLYCDTCKKFLADRLVEGNCPTPGCNYDSARGDQCEKCGKLL
NPTELMEPKCKVCHNTPCIRDTDHLFLELPLLKDRLEAYVNNMSVAGGWSQNAIYTTHAW
LREGLKPRCITRDLKWGVPVPHEKYKDKVFYVWFDAPIGYVSITSCYTTEWEKWWKNPDD
VELYQFMGKDNVPFHTVIFPSTLLGTGENWTLMKTISVTEYLNYEAGKFSKSKGIGVFGN
DAKDTNIPVEVWRYYLLTNRPEASDTLFTWADLQAKLNSELLSNLGNFVNRVLSFIAKDS
ASGYGSIIPDVEEAESHPLTKALGEKVGNYVEQYIEAMEKVKLKQGLKVAMSISGEGNGY
LQESQFWKLYKEDRRSCSIVMRTACGLVYLLACLLEPFMPPFSHEVLKQLNLPPETQLSL
ADEKGDVANSKRPWNIIPAGHKIGTPAPLFKELKDEEVEFYREKFAGSQSDRADRALKAE
TDAKKMAEQLNKTKISDGNKKKERAKKSSETKSKAPATVEGEVSISRLDIRVGLITKAQK
HPNADSLYVEEIDVGEALPRTVVSGLVNFIPLEDMQNRKVCVLCNLKPVSMRGIKSLAMV
LAASNSDHTKVELVEPPKDAAIGERVTFPGFDGKPDDVLNNKKKVWETVQLDLHTNMELV
ACYKDLPFTTSSGICKVASISEGSIG
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaaattgcaaaacaattccgaaacttccaatcccaggcaaacgaaacatatta
attactagtgctttgccttatgtaaacaacgttcctcaccttggcaatattattggatgt
gtgttgagtgctgacgtgtttgcaagatactgtagacttagagggtacaatgcaatatac
atgtgtggtacagatgagtatgggacagctacagagactaaagctttggaggaaaattgt
actcctaagcaaatttgtgacaaatatcatgctattcataaagaagtctataaatggttt
gatataagctttgatgaatttggacgcacatcaacgccacagcagacagaagtttgtcaa
gcaattttcaagaatctcttcgaaaataattggctttctgagaatacaatgcaacagctt
tactgtgacacttgcaaaaagttcttagccgatagacttgtagagggtaactgtccaaca
ccaggttgcaactatgattctgcacgaggagatcaatgtgaaaagtgtgggaaactttta
aatcccacagaactaatggagccaaaatgcaaggtttgtcacaacaccccatgtatccga
gatacagaccatttgtttcttgagctccctttgctgaaggatagattagaagcatatgtc
aacaacatgtcagtggctgggggatggagtcagaatgccatctacacaacacatgcatgg
cttagagaaggacttaaaccaaggtgtataactagagatttgaaatggggggttccagta
ccacatgaaaaatacaaggataaggttttctatgtgtggtttgatgctcctattggatat
gtttcaatcacctcatgctacacaaccgagtgggagaagtggtggaagaatccagatgat
gtggaactgtatcagtttatgggcaaggacaatgtgccttttcacactgtaatattccca
tctacgcttctcggaactggtgaaaactggacgcttatgaaaactatcagcgtaacagaa
tatttgaactatgaagcaggcaaattctctaagagcaagggtataggagtttttggtaat
gatgcaaaagatacaaatattcctgtagaagtatggagatattacttgctgacaaacagg
ccagaggcctcagacactttatttacatgggcagacctacaagcaaagttaaacagtgag
ttgctaagcaacttaggcaattttgtcaatagagttttgagcttcatcgcaaaagattca
gcttcaggttatggttccattattcccgatgttgaagaagcggaatcacatcccttgaca
aaggcattgggtgaaaaagttggaaattacgtggagcagtatatagaagccatggagaag
gttaaattaaagcaaggcttgaaggttgcgatgtctatttctggtgaaggaaatggttat
ctgcaggaaagccagttttggaaactttacaaggaagacaggcgttcgtgttccatagtg
atgagaactgcttgtggtctagtctatcttctggcatgtcttttagagccatttatgcca
cctttttcacatgaggtgcttaagcagctcaacttgcctcctgaaacacaactttcactg
gctgatgaaaaaggtgacgttgcaaatagcaaaagaccatggaacattatacctgcaggt
cacaaaattggaacaccagcaccattgttcaaggagctgaaagatgaagaagttgaattc
tacagagagaagtttgcaggaagtcagtcagatagggcagatagggctctgaaggcagaa
actgatgccaaaaagatggctgaacaactgaacaaaacaaaaatatcagatggtaataag
aagaaggaacgtgcaaaaaaatcttctgaaaccaaatctaaggccccagccactgtcgaa
ggagaagtttccattagtagacttgacattcgcgttggtctcataacaaaggcacaaaaa
catcctaatgccgattcattgtacgtggaagagattgatgttggtgaagctctgcctaga
actgttgttagtggccttgtaaattttattccacttgaggatatgcagaatcggaaggtc
tgcgttctatgcaacctaaaaccagttagcatgagggggataaagtccctggcaatggtt
cttgctgcttctaatagtgatcacactaaggttgaattagttgagccacctaaagatgct
gcaattggagaacgagtcacattccccgggtttgatggcaaacctgatgatgtcttgaac
aataagaaaaaggtttgggaaactgttcagttggatctgcatacaaatatggagttggtt
gcctgctataaagatttgcctttcactacatcatctggtatttgcaaagttgcatccatt
tctgaaggatcaattgggtaa

DBGET integrated database retrieval system