KEGG   Nicotiana tomentosiformis: 104112864Help
Entry
104112864         CDS       T05025                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A-like
  KO
K03254  translation initiation factor 3 subunit A
Organism
nto  Nicotiana tomentosiformis
Pathway
nto03013  RNA transport
Brite
KEGG Orthology (KO) [BR:nto00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    104112864
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nto03012]
    104112864
Translation factors [BR:nto03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    104112864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 104112864
NCBI-ProteinID: XP_018632125
Position
Unknown
AA seq 956 aa AA seqDB search
MATFAKPENALKRAEELINVGQKQEALQALHDLITSRRYRAWQKTLERIMFKYVELCVDM
RRGRFAKDGLIQYRIVCQQVNINSLEEVIKHFMQLATERAELARNQAQALEEALDVEDLE
ADKRPEDLMLSYVSGEKGKDRSDCELVTPWFKFLWETYRTVLEILRNNSRLEALYAMTAH
RAFQFCKQYKRTTEFRRLCEIIRNHLANINKYREQRDRPDLSAPESLQLYLDTRIEQLKV
ATELGLWQEAFRSIEDVYGLMCKVKKTPKPSLMVVYYGKLTEIFWMSSNHLYHAYAWLKL
FSLQKSFNKNLSQKDLQLIASSVVLAALSVSPYDKLYGASHLELENEKERSLRVANLIGF
DVEPKTENREALSRSSILSELVSKGVMTCVTQEVKDLYHLLEHEFLPLDLALKVQPLLSK
ISKLGGKVSSASSVPEVQLSQYVPALEKLATLRLLQQVSQVYQTIQIGNLSKMIPFIDFA
AIEKIAVDAVRHNFVAVKVDHMKHAVFFGKQSIEAEGLRDHLSLFAESLSKARLMIYPPA
KKAAKLGDALSNLAEIVEKEHKRLLARKSIIEKRKEEQERLLLEMERVEETKRREMQKIT
EEAEQKRMAAELEQRRTQRILKEIEERELEEAQALLQEAEKRSKRKKKPVLDGEKMTKRV
IMELALNEQLRERQEMEKKLLKFAKTMDYMERARREEAAPLIESAFQWRLAEEAALHERE
QQQEIELSRQRHAGDLEEKRRLGRMLENKRIFQERAVSSREAEFNRLKQERQERINQIIQ
TRKQDRETRRKLIFFLRFEEEQQKRLQEEEEARKREEAEERKREEAERKAKLDEIAEKQR
QRGRELDEKKRLEREEILRKSTSVLPKPAEPSTVGRPAAAGGSAPAAAAAAPAPAKFVPR
FRREKIDGAGQTSSPETDRWGSGSRPDDRPSDRWRDERKAPSFGGGSRTSWSGSRR
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttttgccaaacctgagaatgctttgaagcgagctgaagagctgattaatgtt
gggcaaaagcaagaagcgctacaagcacttcatgatctgattacatctaggaggtataga
gcttggcaaaagacacttgagagaataatgttcaagtatgtagagttatgtgttgacatg
agaagggggaggtttgccaaggatggcctgattcaatatcgtattgtctgtcaacaagtg
aacattaattcattggaggaggtgataaagcatttcatgcaattagccactgagcgggct
gaactggctcgcaatcaagcacaggccctagaagaagctctggatgtggaagacttggaa
gctgataaaagacctgaagatcttatgttgagttatgttagtggggagaaaggaaaagat
agatctgattgtgaactggtcacaccctggtttaagttcttgtgggagacatatagaact
gttctagagatcttacgcaacaactcaaggttggaggctctgtatgctatgacggcgcac
cgtgcctttcagttctgtaagcagtacaaacgtacaacagagtttcgtcggctttgtgaa
atcatccggaatcacttggcaaatattaacaagtatagagagcagagggaccgtccggat
ctgtctgctccagaaagcctacagttgtatctggacacaagaattgagcaactgaaagtt
gcaaccgaacttggactttggcaggaagcctttcgttcgattgaagatgtatatggatta
atgtgcaaggtaaaaaaaacccctaaaccatcgttgatggttgtgtactatggcaagtta
acagaaatattctggatgtcatcaaatcatctttatcatgcttatgcatggctcaaactc
ttctctcttcaaaagagtttcaataagaacttaagccagaaggatttgcagttaatagca
tcatctgttgttctagctgctctgtctgtgtctccttacgataagctatatggtgcatcc
catctggagcttgaaaatgagaaggagaggagcttgagggtggccaatctcattggtttt
gatgttgaacccaagacagagaacagagaagcgctttcccggtcatcaattctctcagaa
ttggtgtccaaaggtgtgatgacctgtgtcacccaagaagtgaaagatctttatcatctg
ctagaacatgagtttcttcctttggatctggcactgaaagtacaacccttattgagcaaa
atctcgaagcttgggggtaaggtatcttcagcctcttcggttccggaagtgcaactgtcc
cagtatgttccagccttggaaaagcttgcaactctgaggttgctccagcaggtatctcag
gtgtaccagacaatccagattggtaacctgtctaagatgatcccattcattgactttgct
gctattgagaagatcgctgttgatgctgttagacataattttgttgccgttaaagttgat
cacatgaaacatgctgtcttctttggtaaacagagtattgaggctgaaggacttcgggat
cacttgtcactttttgctgaatcccttagcaaggcaaggttaatgatctatccccctgcg
aagaaagctgccaagcttggggatgccctctctaatttagcggagatagtggagaaagag
cacaagagactcctggcacggaagtccataattgagaaacgcaaagaagagcaggagcgt
ttactcttagaaatggaacgagttgaagaaacaaagaggcgagaaatgcaaaagataact
gaagaggcggaacaaaaaaggatggctgctgagttagagcaaagaaggacccaaagaatt
ctcaaggaaatagaggaacgagaactcgaagaggcccaagctttgctgcaagaagctgaa
aagcgcagcaagaggaagaagaaaccagtcttagatggagaaaagatgactaaacgggtt
atcatggagttggccttgaatgagcaactcagggagaggcaagagatggaaaaaaaatta
ctgaagtttgcgaaaactatggattatatggagagagcgagaagagaagaagcagcgcct
cttattgaatctgcatttcaatggcgtttagctgaagaggcggctcttcatgaacgtgaa
cagcagcaagagattgagttgagcagacaacgacatgctggggaccttgaagagaagagg
aggctaggccgcatgttggaaaacaagagaatattccaagaaagagctgttagtagcagg
gaagctgaattcaataggttgaaacaggagagacaggaacgaataaaccagataattcag
acaaggaaacaggatagggagactaggaggaagttgatattctttttgcgattcgaggaa
gagcaacaaaagaggttgcaggaagaagaggaagcccggaaacgtgaagaagccgaggag
cggaagagagaggaagctgaacggaaggccaagttagatgagattgcagaaaagcaaagg
caacgtgggcgtgaacttgatgagaaaaaaaggctggagagagaggagatcttgcggaaa
tccacgtctgtgttaccgaagcctgctgagccttcaactgtaggtcgtcccgcggcagct
ggaggaagtgctcccgcagcagcagctgctgcacctgctcccgcgaagtttgtaccccgg
ttcagaagagagaaaattgatggggcaggccagacgtcatctcctgaaactgacaggtgg
ggcagtggcagcaggcctgacgatcggccatctgatagatggcgtgatgaacgaaaggcg
ccctcatttggtggtggctcaaggaccagttggtcaggctctaggcgctga

DBGET integrated database retrieval system