KEGG   Nicotiana tomentosiformis: 104114161Help
Entry
104114161         CDS       T05025                                 

Definition
(RefSeq) pyruvate decarboxylase 1-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00010  Glycolysis / Gluconeogenesis
nto01100  Metabolic pathways
nto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104114161
Enzymes [BR:nto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     104114161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
NCBI-GeneID: 104114161
NCBI-ProteinID: XP_009622836
Position
Unknown
AA seq 603 aa AA seqDB search
MDAKIGAIDTCKPANNDVGSLPTTNSVTIHTPTVPFNSPDSTLGRHLARRLVQVGVTDVF
GVPGDFNLTLLDHLIAEPGLKFIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLN
AIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLE
DAHELIDTAISTALKESKPVYISIGCNLPGIPHPTFSREPVPFCLSPRLSNQMGLEAAVE
AAAEFLNKAVKPVVVGGPKLRVAKASEAFVELADASGYAVAVMPSAKGLVPEHHPHFIGT
YWGAVSTAFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKKEKAIIVQPDRVTIANGPAF
GCVLMKDFLAALAKRLKHNPTAYENYRRIYVPEGHPLKCEPKEALRVNILFEHIQRMLSG
DTAVIAETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGATLGYAQTAREKRVIAFIGD
GSFQVTAQDISTMLRCGQRTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGE
GKCWTTKVHCEEELVEAIETATEAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPP
NPQ
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgaagatcggagcaattgacacgtgtaaaccggcgaacaacgacgtgggaagc
ttaccaacaaccaacagcgttaccattcacacacctaccgttccgttcaactcaccggac
tccacactaggccgtcatttagcacgccgtttagtccaagtcggcgtcaccgacgttttt
ggcgttcccggcgactttaatcttacacttttagaccacttaatagctgaacctgggctc
aaattcattggctgttgtaacgagctaaatgctgggtatgctgctgatgggtacgctaga
gctcgtggtgttggagcttgtgttgtgacttttactgttggtggacttagtgttcttaat
gctattgctggtgcttatagtgagaatcttcctttgatatgtattgttggtgggcctaat
tctaatgattatggaactaacagaatccttcatcatactattggattgcctgattttagt
caagaacttcgttgctttcaaactgttacttgttaccaggctgtggtgaataacttagag
gatgcacatgaactgatcgatacagcgatatctacggcgttgaaagagagtaagccggtt
tatataagcataggttgtaacttgccggggattccacaccccacttttagccgtgaaccg
gtaccattttgcctctctcctagattgagtaatcagatgggtttggaagcagcagtggag
gcagctgcagagttcttaaacaaagctgtgaaaccagttgttgtgggagggccaaaattg
cgcgttgcaaaggcatctgaggcatttgttgaattggcggatgccagtggatatgctgtt
gcagtgatgccatcggctaaggggctggttccagaacaccatcctcatttcattggaact
tattggggtgcagtgagcacggctttctgcgctgaaattgtggaatctgctgatgcttac
ttgtttgctgggcctatttttaacgactatagctctgttgggtattctctgcttcttaag
aaagagaaagcaatcattgtccagccggatcgtgtgactattgcgaatggacctgcattt
ggttgtgttctaatgaaggattttcttgccgctttggccaagaggctaaagcacaacccg
actgcatacgaaaattatcgtaggatttatgttccagaaggacatcctcttaagtgcgag
cctaaggaggcattaagggttaatattctctttgagcacattcagaggatgttgtctggt
gacactgctgtgattgctgagacaggggattcatggttcaattgccagaagcttaaactg
cccgagggatgcgggtatgagttccagatgcagtatggatctattggttggtctgttggc
gcaactcttggttatgcgcaaacagcacgagaaaagagggtgattgctttcattggtgat
ggtagcttccaggtgactgctcaggatatatcaacaatgctgcgatgcgggcagaggact
atcatcttcttgataaacaatggtggttatacaattgaagttgagatccacgacggacct
tacaatgtgattaagaactggaattacactggactagttgatgcaatccataacggggaa
ggaaaatgttggacaacaaaggttcattgtgaagaggagcttgtggaagcaattgaaact
gcaactgaagccaagaaagattgcttgtgtttcattgaagtgattgttcacaaggatgac
accagcaaagagctgcttgaatggggttctagagtttctgccgctaatagtcgcccacca
aatcctcagtaa

DBGET integrated database retrieval system