KEGG   Nicotiana tomentosiformis: 104115058Help
Entry
104115058         CDS       T05025                                 

Definition
(RefSeq) nitrilase-like protein 2
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
nto  Nicotiana tomentosiformis
Brite
KEGG Orthology (KO) [BR:nto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104115058
Enzymes [BR:nto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     104115058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 104115058
NCBI-ProteinID: XP_009623924
Position
Unknown
AA seq 306 aa AA seqDB search
MNFCLNTQLSTRYNFTVASAGKSIAMANSVRIAAAQMTSVNNLAVNFATCSRLVKEAASA
GAKLLCFPENFSFVGDLQGESLKIAETLDGPIMKGYCSLARESNIWLSLGGFQEKGSDDA
HLRNTHVLIDDNGNIRSTYSKMHLFDVDVPGGAVYKESSFTEAGKDIVVVDSPFGRLGLT
VCYDLRFPEVYQQLRFNHDAQVLLVPAAFTTVTGQAHWEILLRARAIETQCYVIAAAQAG
KHNEKRESYGDTLIIDPWGTIVGQLSDRWSTGITVADIDFSLIDSVRAKMPVSKHRKPAE
FWNQHP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatttctgtctgaatacacaattaagcacccgttacaacttcacagtggcatctgcc
ggaaaatccatagccatggccaactccgtcagaatcgccgctgctcagatgacgtccgtt
aataatctcgccgttaacttcgctacttgctctcgcctcgttaaggaagcagcttcagca
ggggctaaattgctatgttttcctgaaaatttctcttttgtgggagacctacagggagag
agtcttaaaattgctgagaccctagatggacctattatgaaaggctactgttctcttgca
agggaatcaaatatttggttgtcgctaggaggattccaagaaaaagggagtgatgatgca
cacttgcgcaacactcatgttctcattgatgataatggaaatattaggagcacgtacagt
aagatgcatctgtttgatgtggatgttcctggaggtgcagtttataaagagagtagtttc
actgaagctgggaaggatattgttgtggtggacagccccttcggccgtctgggtctcact
gtttgttacgacttaagattccctgaggtgtatcaacaacttaggttcaatcatgatgca
caggttttgttagtgcctgctgctttcacaacggtgactggtcaggcacattgggagatt
cttctccgcgctcgtgcaattgaaacacagtgttatgtcatagctgctgctcaagcaggg
aagcataatgaaaaaagggaaagctatggagataccttaataattgatccatggggaaca
atagttggtcaattgtcagatcgatggtcaacaggtattactgttgcagatattgacttc
tcattaatagattcagtccgagcaaagatgccagtgtctaagcatcgcaagcctgctgaa
ttctggaatcagcatccttga

DBGET integrated database retrieval system