KEGG   Nicotiana tomentosiformis: 104115298Help
Entry
104115298         CDS       T05025                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like
  KO
K20538  mitogen-activated protein kinase 8 [EC:2.7.11.24]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:nto00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    104115298
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nto01001]
    104115298
Enzymes [BR:nto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104115298
Protein kinases [BR:nto01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104115298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 104115298
NCBI-ProteinID: XP_009624184
Position
Unknown
AA seq 590 aa AA seqDB search
MGGGGTFVDGVLRWFQRRHSNEDAILTDLQKPHNTHLQERAEDNNQEFTITEDFDITGLK
LIKVPKRLSFPISAHSSMDPLKKNALETEFFTEYGEASRYQVQEVIGKGSYGVVGSAVDT
HTGERVAIKKINDVFDHVSDATRILREIKLLRLLRHPDIVEIKHIMLPPSRREFKDIYVV
FELMESDLHQVIKANNDLTAEHYQFFLYQLMRGLKYIHTANIFHRDLKPKNILANADCKL
KICDFGLARVSFNDVPSAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELL
SGKPLFPGKNVVHQLDLITDLLGTPPPETVAKIRNEKARRYLSSMRKKQPVPFEKKFPNA
DPLALRLLERLIAFDPKDRPSAEEALSDPYFRGLSNADHEPSRPPISKLEFEFEKRKLAK
EDVRELIYREILEYHPQMLQEYLSGGDQTSGFMYPSGVDRFKRQFAHLEEHYGKGERSTP
LQRQHASLPRERVPAPKNDTSSQNNDCEKRTVSTALQSSPGQSEGSENSIVGTQNGSNQA
NNSARSLLKSASISASKCVEVKNRNTEEEPIEEANEEVDDLSQKVAALHT
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggggggtggtggtacatttgtggatggtgttcttcgctggtttcaacgtcgtcatagt
aatgaagatgcgatcttgactgatcttcagaaaccccataatacccatttacaagaaaga
gcagaagataataatcaagagtttaccattactgaggattttgacattacaggtctaaag
cttatcaaagtacccaaacggcttagtttccctatttccgcccattcttctatggatcct
ctcaaaaagaatgcgttggagacggaattctttacggaatatggagaggcaagtagatac
caagttcaggaagtaattggaaaaggcagctatggagtcgtgggatctgctgtcgatact
catactggtgaaagagttgcaatcaagaaaattaatgatgtctttgatcatgtttctgat
gctacaagaatcttgagagaaatcaagcttcttcggctacttaggcatccagatattgta
gaaataaagcacattatgttgcctccttctcggagagagtttaaagatatttatgttgtt
tttgaattgatggaatcagatctccatcaggtgattaaggccaataatgatcttactgct
gagcattatcagtttttcctataccagcttatgcgtggactaaaatatattcatacagca
aatattttccaccgggatttaaagcctaagaatattcttgctaatgctgactgtaagttg
aagatttgtgattttggtcttgctcgtgtatcattcaatgatgtgccatcagctattttc
tggactgattatgttgcaactcgatggtatcgtgcccctgagctatgtggctcctttttc
tctaagtatactcctgctattgatatttggagcatcggatgcatatttgcagaattgctt
tctggaaaaccgttatttcctggaaagaatgtggtgcatcaattagacctaatcacagat
ttgcttgggacacctcctcccgaaacagttgcaaagatcagaaatgaaaaggcaagaaga
tacctcagtagcatgcggaagaaacaaccagttccatttgaaaaaaagtttccaaatgca
gatcctttggcgttacggctacttgaacgactgattgcatttgaccctaaagatcggcca
tcggcagaagaggcattgtcggatccatatttccgtggtttatcaaatgctgatcatgaa
ccatctaggccaccaatatcaaagcttgagtttgaatttgagaaaagaaaactggcaaaa
gaagatgttagagaactcatctatcgcgagattttagaatatcatcctcagatgcttcag
gagtatcttagtggtggagatcagacaagtggctttatgtacccaagtggtgttgatcgg
ttcaagcgacaatttgcacatctggaggagcactacggtaaaggtgaacgtagcaccccg
cttcagaggcagcatgcttccttgcctagggagcgagttcctgcaccaaaaaatgacacc
tcttcccaaaataatgattgtgaaaagcgaactgtttcaacagctcttcagagctcacca
gggcagtctgagggatcagagaactcaattgtcggtacacaaaatggaagtaatcaggca
aacaacagtgctcgtagcttgctgaaaagtgctagcatcagtgcttctaagtgtgtggaa
gttaaaaacagaaacacagaggaagagccaattgaagaggcaaacgaggaagttgatgat
ttgtctcaaaaagttgcagctcttcatacttaa

DBGET integrated database retrieval system