KEGG   Nicotiana tomentosiformis: 104117109Help
Entry
104117109         CDS       T05025                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00052  Galactose metabolism
nto00500  Starch and sucrose metabolism
nto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104117109
   00500 Starch and sucrose metabolism
    104117109
Enzymes [BR:nto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104117109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104117109
NCBI-ProteinID: XP_009626391
Position
Unknown
AA seq 569 aa AA seqDB search
MASLKLYIPALILISIHVIRQFEAASHEIETPDQIYRTAFHFQPAKYWMNDPNGPMIYMG
IYHFFYQYNPYDAQSGNIVWGHSTSTDLINWTPQPPALLRSEPYDFKGCFSGSTTILSGG
KPAILYTGVDFSDIQVQNLAVPKNLLDPYLIEWVKSPYNPLITPNSVNKIDGQNFRDPTT
AWVNPTDGNWRMVVGNKKNNTGIGLLYKSKNFIDWIQTEQPLHFLNNSGMWECPDFFPVS
TISQIGLDTSIMGPNVKHVFKVSVANSDYYTIGIYNPNKDIFVPDNESLDIGLGFRYDYG
KYYASKTFFDSATNRRILFGWVSEAVNIVDINSIRGWAGLQGIPRRIWLQKSGNQLLQWP
IVEIEKLRINNPVVEGTTALMAGSVREISGVTATQADVEISFAAKTLEKAEIWEANWTNP
QQVCSIKGASVKGGIGPFGLLVLASKDMQEYTAVFFRIFKGNNNNFIVLMCSDQSRSSLH
LPSTDYDKTTYGAFLNVDPVQEKLSLRTLIDHSIVESFGGEGKACITARVYPTNLAVDGG
SHLYVFNNGSENVEISNLTAWSMKTAQIN
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggccagccttaaactttatattccagctttaatactaatttctattcatgtaattcgg
caatttgaagctgcttctcatgaaatagagacacccgatcagatatacaggactgcgttt
cattttcaacctgctaagtattggatgaacgatcctaatggaccaatgatatacatggga
atttaccatttcttctaccaatacaatccttacgatgcacaatccggaaacatagtctgg
ggacattctacatcaactgatcttatcaactggacacctcagccgccggcactactccga
tcagagccttatgattttaaaggctgtttttcaggttctacaacaattctctccggcgga
aaaccggcaattctctataccggagtagacttctccgatatccaagttcaaaatctagcc
gtgcccaaaaatttattggacccttaccttatagaatgggtaaaatcaccttataatcca
ctaataacacctaattcagtgaataaaattgatggtcaaaatttcagagacccaactact
gcttgggtaaatcctacagatggtaattggagaatggtagttggaaataaaaaaaataac
acaggaattggtttattgtacaaaagcaagaattttattgattggattcaaactgaacaa
cctttgcattttttaaacaattctggaatgtgggaatgtcctgattttttcccagtttca
acaattagtcaaattggtttagacacttcaattatgggtccaaatgtaaaacatgtattc
aaagtaagtgtagcaaattctgattactatacaattggaatatataatccaaataaggat
atttttgtcccggataatgaatccttggatattggattaggatttagatatgattatgga
aagtattatgcttcaaaaacattttttgatagtgctactaataggagaattttatttgga
tgggttagtgaagcagtaaatattgttgatataaatagtattagaggttgggctggtctt
caaggaattcctagaagaatttggcttcagaaatctggaaatcagctgttgcaatggcca
atagtcgaaattgaaaagcttcgaattaataatccagttgttgaaggtactactgcgctt
atggctggatcagtacgtgaaatatccggcgtcacagctacacaggcagatgtagaaatt
tctttcgcagcgaaaacgttggaaaaggcagagatatgggaagcaaattggacaaatcca
cagcaagtttgtagcataaaaggtgcatcagtaaaaggtgggattggaccatttggattg
cttgtcttggcatctaaggacatgcaagaatatactgcagttttcttcagaattttcaaa
ggaaataacaacaattttatagtgctcatgtgtagtgaccagagcaggtcttccttacac
ttgccttcaactgattatgacaaaactacttatggagccttcttgaatgtggatcctgtt
caagaaaaattgtcgctaaggactttgattgatcactcaatagtggagagctttggtgga
gagggaaaagcttgcattacagcaagggtttacccaactaatttagcagtggatggtggg
agccatttgtatgtcttcaacaatggttcagagaatgttgagatctcaaatttaactgct
tggagcatgaaaacagcgcagatcaattga

DBGET integrated database retrieval system