KEGG   Nicotiana tomentosiformis: 104119807Help
Entry
104119807         CDS       T05025                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
nto  Nicotiana tomentosiformis
Brite
KEGG Orthology (KO) [BR:nto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104119807
Enzymes [BR:nto01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     104119807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 DAO EF-hand_6 EF-hand_5 EF-hand_7 Pyr_redox_3 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 104119807
NCBI-ProteinID: XP_009629692
Position
Unknown
AA seq 576 aa AA seqDB search
MRGFSYLKRALHIRSSYSRLLVASCISSGGLIVYAECNVDSNEKVVQKSRSDSGKKKIVV
LGTGWAGTSFLKDMDISSYDIEVVSPRNYFAFTPLLPSVTCGTVEARSVVEPVRNIIKKR
SGEIQFWEAECLKIDPENHKVLCHSLVENLVGENDFALEYDYLVVAVGAQVNTFNTSGVL
EHCHFLKEVEDAQRIRRTVIDCFEKAVLPGLSEEERRTNLHFVIVGGGPTGVEFAAELHD
FVHEDLVNLYPSVKDLVKITVIQSGDHILNTFDERISSFAEQKFQRDGIEVLTGCRVVSV
SEHSVNMKVKSTGEYDVVPHGMVVWSTGVGTRPFVKDFMEQIGQGKRWILATDEWLRVTG
CPDVYAIGDCATVDQRKIMEDISTIFEAADTDHSGTLTIEEFQDVLEDIIIQYPQVELYL
KSNQLFDVTELFKDSEGNEREEVDIEGFKLALSHVDSQMKSLPATAQVAAQQGSYLASCF
NRWEQCNAKPEGPRLFGSAGRHAFLPFRYRHLGQFAPLGGEQAAAELPGDWVSMGRSTQW
LWYSVYASKQVSWRTRILVVWDWTRRYIFGRDSSRI
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtttctcatatttgaaaagagctctccatatccgctcttcttattccagactt
ttggttgcctcctgtatcagtagcggaggtctcatagtatatgcagaatgtaatgtagac
agcaacgaaaaagttgtccaaaagagtcgatcagattcagggaagaagaaaatagtggta
cttggaacaggatgggctggtactagtttcctaaaggatatggatatttcttcctatgat
attgaagtggtttctccgcgtaactactttgcgtttactccattgttacctagtgtcact
tgtggaacagtcgaggcacggagcgttgttgagccagtgagaaacattataaagaagaga
agtggagaaatacaattttgggaagcagaatgtctcaagattgatcccgaaaaccataaa
gtcctttgccattctcttgtggaaaatttggttggagagaatgattttgccctagaatat
gactatttggttgtagcagtaggagctcaagtaaatacttttaacacttcaggtgtcttg
gaacattgtcactttttgaaggaagtcgaagacgctcaaaggattcggagaactgtcata
gattgttttgaaaaagctgtgctcccgggcttaagtgaagaagagcgaaggaccaacctc
cattttgttatagttggagggggtccaactggagtggaatttgcagctgagttacatgac
tttgttcatgaagatttggtaaacttatacccttcagttaaggatctagtgaagataaca
gtcatccaatctggagatcatatcctgaacacgtttgatgaaagaattagctcatttgct
gaacagaagtttcaaagagatggaattgaggttttgacaggttgccgtgtcgttagtgtt
tctgaacattcagttaacatgaaagtaaaatcaacaggagaatatgatgttgtacctcat
gggatggttgtatggtcaactggagttggtactcgcccttttgtgaaggatttcatggaa
caaattggccagggaaagagatggattctagcaactgatgaatggttgcgagtaacgggt
tgtcctgatgtgtatgctattggtgattgtgccactgtagatcaacgtaaaattatggaa
gatatttcaaccatttttgaagctgcggatacggatcattctggaaccttaactatagaa
gaatttcaagatgttttggaagacataatcatccaatatcctcaagtggagttgtatctg
aagagcaatcagttatttgatgtaacagagttattcaaggattcagagggaaatgaaaga
gaggaggtagatattgaagggtttaagttagctctttctcatgtagattcccaaatgaag
agtctacctgctactgctcaggttgctgctcaacaaggttcgtatcttgccagctgcttt
aaccgttgggagcaatgcaacgctaagcctgaaggcccgcgcctctttggaagtgcgggg
cgtcatgcatttttacccttccggtatcgacatttagggcaatttgcaccattaggtggg
gagcaagcagcagcagaacttccaggagactgggtttcaatgggtcgtagcacacagtgg
ctctggtattctgtatatgcaagcaagcaagttagctggcgtacaaggatcctagtggtc
tgggactggacaagaagatacattttcggaagagattcaagccgaatatga

DBGET integrated database retrieval system