KEGG   Nicotiana tomentosiformis: 104120691Help
Entry
104120691         CDS       T05025                                 

Definition
(RefSeq) putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00330  Arginine and proline metabolism
nto00360  Phenylalanine metabolism
nto00380  Tryptophan metabolism
nto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    104120691
   00360 Phenylalanine metabolism
    104120691
   00380 Tryptophan metabolism
    104120691
Enzymes [BR:nto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     104120691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 104120691
NCBI-ProteinID: XP_009630803
Position
Unknown
AA seq 519 aa AA seqDB search
MAIQGQFSVLFSSLLILLLCFISFNNTNGNCEQEYHFNIEEATIKDIQLAFAQNKLTSRK
LVDLYLHKIETLNLVLRGVIEVNPDVRKQADEADKQREIIKKKMSSLHGIPVLVKDSIAT
KDKLNTTAGSYALLGSEVRRDATVVERLRNDGALILGKASMSEWYHFRSFSIPDGWSATG
GQGVNPYVEGGSPCGSSSGSAISIAANMVAVSLGTETDGSIIFPAKYNAVVGLKPTVGLT
SRVGVIPLSPRQDTIGPICRTVSDAVYVLDSIVGFDIRDLEATRAAAKFIPAGGYKQFLN
EDGLKGKRLGVVRHPSILTGHLQTLRQRGAVVLDNLEIPNIDVVLDPNQSGAEVALLAEF
KLSLNNYLAELVTLPVRSLAEIIAFNQNNPKLEGSKSFGQEIFIAAEATKGIGEKERKAM
AMMEKLSEDGFEKLMIENELDALVNIGSGVSTVLAIGGYPAIIVPAGYNSTNGMPFGICF
GGVKGSEPKLIEIAYAFEQATMICRPPFSKSINTLIPSF
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcgattcagggtcaattttctgttctcttttcctcattgctaatattgctgctttgc
tttataagtttcaataacacaaatggaaattgcgagcaggagtaccatttcaatattgaa
gaagctacaatcaaagacatacaattggcctttgcccaaaacaagctcacatcaagaaaa
ctcgttgacttgtacttgcataaaattgagacccttaatcttgttcttcgtggagttatc
gaagtgaatccggacgtgcgaaaacaagccgatgaagctgataaacaaagggagataatt
aagaagaaaatgagcagtttacacggtattcctgttctggtcaaagatagcatagcaaca
aaggataaacttaatactactgcggggtcttacgcgttgctaggttcagaggtgcgtaga
gatgctacagttgtggagaggctaaggaatgatggtgctttgattttgggaaaggctagt
atgagtgaatggtaccattttcgatctttcagtattcctgatggatggtctgctacaggt
ggccaaggtgtgaacccgtatgtggaaggaggaagtccatgtggttcaagcagtggatct
gcaatatctatagcagctaacatggtggctgtgtcattaggaactgagactgacggctca
attatcttccctgctaaatacaatgctgttgtaggcctcaaacccaccgttggactcact
agccgtgttggtgtcattcccctctctcctcgacaggacacaattgggcccatatgcaga
acggtttcagatgctgtatatgttcttgattccattgttggcttcgatataagagacctt
gaagcaacaagggcagcagcaaagttcattccagccggtggttataaacaatttctcaat
gaagatggccttaagggaaagagattgggtgtggtaagacatccttcgatattgactggt
catttgcagacactaaggcaaagaggtgcagttgtattggataatcttgaaattccaaat
attgatgtggttttagaccccaatcaaagtggtgcggaagtggcattactagcagagttc
aagctctcactcaacaattatctagcagagctagtcacactcccagttagatcactcgct
gagataatagccttcaaccagaataacccaaaattggaaggaagtaaaagctttggtcaa
gaaattttcatagcagcagaagcaacaaaagggattggagagaaagagaggaaggcaatg
gcgatgatggagaaactttcagaagatggatttgagaaactgatgatagagaatgaactg
gatgccttagtgaacataggttcaggtgtttccacagttttggctattggaggatatcca
gcaataatagttcctgctggttataatagtactaatggtatgccttttggtatatgcttt
ggaggggtgaaaggaagtgaaccaaagctgattgagatcgcttatgcttttgaacaagcg
accatgatctgcagacctcctttctccaagtcaattaatactcttattccttcattttaa

DBGET integrated database retrieval system