KEGG   Nicotiana tomentosiformis: 104121285Help
Entry
104121285         CDS       T05025                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00260  Glycine, serine and threonine metabolism
nto01100  Metabolic pathways
nto01110  Biosynthesis of secondary metabolites
nto01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    104121285
Enzymes [BR:nto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     104121285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_3 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 104121285
NCBI-ProteinID: XP_009631533
Position
Unknown
AA seq 359 aa AA seqDB search
MVMRTVDLRSDTVTKPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEIARIMGKEAGLFVP
SGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGIATLGGVHPRTVKNNEDGTMDLDL
IEAAIRDPSFEICYPTTRLICLENSHAHSGGRCLSAEYTDKVGELAKKYGLKLHIDGARI
FNASVALGVPVHRLVRAADSVSVCLSKGLGAPVGSVVVGSKSFIAKAKILRKTLGGGMRQ
VGVLCAAAFIGFQENLVKLEGDHKKAKILAEELNKIKGLKVDIAAVETNIVYCDILKGSK
ISETEMCKILEQHGLLILPEGLMRIRFVIHHQISENDVHYAVSCVQRALAGVAEENGDK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgagaaccgtggatcttcgctcggacacagtcactaaaccaactgaagccatg
cggaacgcaatggccaacgctgaagtggatgacgatgtattgggttatgatccaactgcc
caacgccttgaagccgagatcgcaaggataatgggcaaagaagcagggctatttgttcct
tcaggcactatgggcaaccttatcagtgtgctgactcattgccaaattagaggcagtgaa
attattcttggtgattattcacatatccatatttatgaaaatggaggcattgccactctc
ggaggtgttcatccgaggacagtgaagaacaatgaagatggaacaatggatcttgattta
attgaagctgcaattcgagatcctagctttgagatatgttacccgaccactaggctgatc
tgcttggagaattcacatgcacactcaggaggcagatgcctttctgcagagtatacagac
aaagtcggagagctagcaaagaagtatggtctgaagcttcacattgatggagctcgtata
ttcaatgcatcagttgcacttggagtgcctgttcatagacttgtacgtgctgctgattca
gtttcggtatgcttatcaaaaggtcttggtgctccagttgggtctgtggttgttggttca
aagagcttcattgccaaggcaaaaattctgaggaagactctaggcggtggaatgaggcag
gttggtgtcctttgtgctgctgcttttatcggtttccaagagaatcttgttaagctggaa
ggagatcacaaaaaggctaagattttggctgaggaactaaacaaaatcaaagggctgaaa
gttgatattgctgccgtagagactaacattgtatattgcgatatactgaaggggtcaaag
atcagcgaaacagagatgtgcaagattttggagcaacatggtttacttatactaccagaa
ggcctaatgagaatcagatttgttattcatcaccagatttcagaaaatgatgtgcactat
gcggtatcttgtgttcagcgagctttagcaggagtggccgaagaaaatggtgacaagtaa

DBGET integrated database retrieval system