KEGG   Nicotiana tomentosiformis: 3776294Help
Entry
3776294           CDS       T05025                                 

Gene name
rpl22, NitoCp073
Definition
(RefSeq) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
nto  Nicotiana tomentosiformis
Pathway
nto03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nto00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3776294 (rpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nto03011]
    3776294 (rpl22)
Ribosome [BR:nto03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3776294 (rpl22)
  Bacteria
    3776294 (rpl22)
  Archaea
    3776294 (rpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 3776294
NCBI-ProteinID: YP_398904
UniProt: Q33BZ2
AA seq 155 aa AA seqDB search
MLKKKKTEVYALGEHISMSADKARRVIDQIRGRSYEETLMILELMPYRACYPILKLVYSA
AANASYNMGSSEANLVISKAEVNGGTTVKKLKPRARGRSFPIKRSTCHITIVMKDISLDD
EYVEMYSLKKTRWKKKPTAMPYRDMYNSGGLWDKK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagaagaaaaaaacagaagtatatgctttaggtgaacatatatctatgtctgct
gacaaagcacgaagagtaattgatcaaatccgcggccgttcctatgaggaaacgcttatg
atactagaactcatgccctatcgggcatgttatcccattttgaaattggtttattctgca
gcagcaaatgctagttacaatatgggttccagcgaagccaatttagtcattagtaaagcc
gaagtcaatggaggtactactgtgaagaaattgaaacctcgagctcgaggacgtagtttt
ccaataaaaagatcgacctgtcatataactattgtaatgaaagatatatctttagatgat
gaatatgtagagatgtattcgttaaaaaaaacgagatggaaaaaaaaacctacagctatg
ccatatcgtgatatgtataatagtgggggattatgggacaaaaaataa

DBGET integrated database retrieval system