KEGG   Nocardia terpenica: CRH09_06320Help
Entry
CRH09_06320       CDS       T05168                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
ntp  Nocardia terpenica
Pathway
ntp00360  Phenylalanine metabolism
ntp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ntp00790  Folate biosynthesis
ntp01100  Metabolic pathways
ntp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CRH09_06320
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CRH09_06320
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CRH09_06320
Enzymes [BR:ntp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     CRH09_06320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ATL65885
UniProt: A0A291REY5
Position
complement(1376014..1376907)
Genome map
AA seq 297 aa AA seqDB search
MFNEAQLYSPVTTTTDGGVTVHLSDEHPGVHDPEYRARRNGIAAQALSYRDGGPLPRIAY
TDEEEEVWRIVSAELARKHRKLASAEVLAGEERLGLPVDHIPQLDEVTAKLVPLSGFRYV
PAAGLVPLRQFFGSFADRTFHSTQYIRHHSAPLYTPEPDAIHEIIGHANQLASPRFAAIY
AEVGAAVARLETDAALKFLADVFWFSMEFGVVREQGEVRCYGAGLLSSYGEIEEFRDAEL
RPLNITEMGTAVYDITHYQPVLYCAESIAEIEDVVGGFFATMTDDVVARQRATAGLA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacgaagctcagctgtactcgccggtgaccacgacgaccgacggtggcgtgacg
gtgcacctgagcgacgagcaccctggtgtgcacgacccggagtaccgggcccgccgcaat
gggatcgccgcccaggcgctgtcctaccgggacggtgggccgctcccccgcatcgcctac
accgacgaggaagaagaagtgtggcggatcgtctccgccgaactggcgcgcaagcaccgc
aagctcgcctcggcggaagtgcttgcgggagaagagcgtctgggcctgccggtcgatcac
atcccgcagctcgacgaggtgacggcgaagctggtgccgctcagcggtttccgctatgtg
cccgcggccggtctggtcccgctgcggcagttcttcggctcgttcgcggaccgaaccttc
cactccacccaatacattcggcatcactcggcgccgctgtacaccccggagcccgatgcc
atccacgaaatcatcgggcacgccaaccaattggcgagcccgcggttcgcggccatctac
gccgaggtgggcgcggcggtggcgcggctggaaaccgatgcggcactgaagttcctggcc
gatgtgttctggttctccatggagttcggcgtggtgcgggagcagggcgaggtgcgctgc
tacggcgcgggcctgctgtcgtcctacggcgagatcgaggagttccgcgacgcggagctc
cgcccgctcaacatcaccgagatgggcaccgccgtctacgacatcacccactaccagccg
gtgctctactgcgcggagtcgatcgccgagatcgaggatgtggtgggcgggttcttcgcc
accatgaccgacgacgtggtcgcgcggcagcgggccaccgccgggctcgcctga

DBGET integrated database retrieval system