KEGG   Nocardia terpenica: CRH09_12585Help
Entry
CRH09_12585       CDS       T05168                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ntp  Nocardia terpenica
Pathway
ntp00670  One carbon pool by folate
ntp01100  Metabolic pathways
ntp01120  Microbial metabolism in diverse environments
ntp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CRH09_12585
Enzymes [BR:ntp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CRH09_12585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ATL66920
UniProt: A0A291RHX1
Position
2849344..2850342
Genome map
AA seq 332 aa AA seqDB search
MSFDNARGRSTPGRLSRTPQVSGTPSVVGRLGPRPDGTIPFSVEFNPPRDAANEARLWRA
AREFERMHPAFVSMTYGAGGSTRDRTARVTGQLARETTLLTVAHLTAVGHSVAELRSIMG
TYADSGIRNLLVLRGDPPGDPLGEWQRHPEGLEYAEELVRLVRGLGDFHVGVASFPQGHH
RSPDLDHDTAHLCAKLRAGAEYSITQMFFDVDDYLRLRDRVVACDPIEGAKPIIPELMPI
TSLRTVQRAEELSGRPLPTPLRERLERAGGADPDANRAAVREVGIEIATEIAQRLIDEGA
PCLHFITLNFAKATSEVLTNLGYTVTAAPVGA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttcgacaacgcacggggacgttcgaccccaggccgactttcccggacgccgcag
gtttccggaactccctccgtcgtgggtcggctcgggccgcggcccgacgggacgattccg
ttctcggtggaattcaatccgccgcgcgacgccgccaacgaggcccgattgtggcgcgcg
gcccgcgaattcgagcgcatgcatccggcgttcgtctcgatgacctacggcgcgggcggc
tccacccgcgaccgcaccgcccgcgtcaccggtcagctggcgcgcgagaccacgctgctg
accgtcgcccacctcaccgccgtcgggcacagcgtggccgaactgcggtccatcatgggc
acctacgccgactcgggtatccgcaatctgctggtgctgcgcggggatccgcccggcgac
ccgctcggcgagtggcagcggcaccccgagggcctggagtacgccgaggaactggtccgc
ctggtgcgcgggctcggcgacttccacgtcggggtggcgtcgttcccgcaggggcaccac
cgctccccggacctcgaccacgacaccgcccacctgtgcgcgaaactgcgtgcgggcgcg
gagtattcgatcacccagatgttcttcgacgtggacgactatctgcggctgcgggaccgg
gtcgtcgcgtgcgatccgatcgagggcgccaagccgatcattcccgaactcatgcccatc
acctccctgcgcaccgtgcagcgcgccgaggaactgtccggccgccccctgcccaccccg
ctgcgggagcgcctggaacgcgcgggcggcgccgaccctgacgccaaccgcgccgcggta
cgcgaggtcggcatcgaaatcgccaccgaaatcgcccagcgcctgatcgacgagggcgcc
ccgtgcctccacttcatcaccctgaacttcgccaaggccaccagcgaggtcctgaccaac
ctcggctacacggtaacggccgccccggtcggagcctga

DBGET integrated database retrieval system