KEGG   Nocardia terpenica: CRH09_14215Help
Entry
CRH09_14215       CDS       T05168                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
ntp  Nocardia terpenica
Pathway
ntp00520  Amino sugar and nucleotide sugar metabolism
ntp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CRH09_14215 (nagA)
Enzymes [BR:ntp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     CRH09_14215 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ATL67178
UniProt: A0A291RIR9
Position
complement(3204304..3205470)
Genome map
AA seq 388 aa AA seqDB search
MTLIGAGTVVLDGRIARPGWLELSDGRILACGTGIAPRRPDIELPEHIVVPGFVDMHVHG
GGGGSYSDATAADIRDATRFHRRHGTTSTMASVVTTAPDDLLRTVALLADEVEAGTLAGI
HLEGPWLSPARRGAHAPELLREPDPAEIEAVLAAGRGTVRMVTLAPELPGAMPAIERLVA
ANVVVAVGHTDATYEQARAAIDAGATVGTHVFNAMRPLHHREPGPIVALLEDPRVTVELI
GDGVHIHPALHRHLVQTVGADRIALVTDAMAAAGTPDGEYRLGPVDVTVCCGVAHVSGTS
TIAGSTATMAQLFRAAVDSAGPDPDTALLAAVRMTATTPSRALGLTDVGTLRPGLHADLV
VLNQNYEPTAVMRRGRFPDNAPLPSPTS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctcatcggcgcgggcacggtggtgctcgacggacggatcgcgcggcccggctgg
ctggagctgtcggacggtcgaatcctggcctgcggcaccgggattgcgccccggcggccc
gatatcgagctgcccgagcacatcgtggtgcccggattcgtcgacatgcacgtgcacggc
ggcgggggcggttcgtattccgacgccaccgccgcggatatccgggacgcgacgcggttc
catcggcggcacggcaccacctcgaccatggccagcgtggtgaccaccgcgccggacgat
ctgctgcgcaccgtcgcgctgctcgcggacgaggtcgaggcgggcacgctggcggggatt
catctggaggggccgtggctgagcccggcccgccgcggcgcgcacgccccggagctgctg
cgcgagcccgatcccgccgagatcgaggcggtgctcgcggccgggcgcggcacggtgcgg
atggtcaccctcgcgcccgagttgcccggcgccatgcccgcgatcgagcggctggtggcg
gcgaatgtcgtggtggccgtgggtcataccgacgccacctacgagcaggcgcgggccgcg
atcgacgcgggcgccaccgtcggcacgcacgtgttcaatgcgatgcggccgctgcatcac
cgggagccggggccgatcgtggcgctgctggaggatccccgggtgaccgtcgaactgatc
ggcgacggcgtccacatccatccggcgctgcaccgccatctggtgcagaccgtgggcgcc
gaccggatcgcgctggtcaccgacgccatggccgccgcgggcacacccgacggcgaatac
cggctcggcccggtcgatgtgacggtctgctgcggcgtcgcgcacgtctcgggaacctcc
acgatcgcaggcagcaccgccaccatggcccaactgttccgcgcggccgtcgacagcgcc
ggacccgaccccgacacagccctgctagccgccgtccgcatgaccgcaaccaccccgtcc
cgcgccctcggcctcaccgacgtaggcaccctccgccccggcctacacgccgatctcgtt
gtcctgaaccaaaattacgagccaaccgccgtcatgcgccgcggccggttccccgacaac
gccccgctaccgtcaccgacgtcctga

DBGET integrated database retrieval system