KEGG   Nocardia terpenica: CRH09_16080Help
Entry
CRH09_16080       CDS       T05168                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
ntp  Nocardia terpenica
Pathway
ntp00460  Cyanoamino acid metabolism
ntp00500  Starch and sucrose metabolism
ntp01100  Metabolic pathways
ntp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CRH09_16080
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    CRH09_16080
Enzymes [BR:ntp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     CRH09_16080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like PA14
Motif
Other DBs
NCBI-ProteinID: ATL67493
UniProt: A0A291RIR3
Position
3618613..3621003
Genome map
AA seq 796 aa AA seqDB search
MDDRIEELLARLDLTAKLRLISGAGMFRMAGDPAIGLAEMPISDGPSGVRGEHWDERDPS
VSLPSGTALAATWNRELVGEIGALIAAEARRKGVYAVLGPTINLHRTPLGGRHFECFSED
PMLTAELAAAYVRSVQAHGVAACPKHYVANDSETDRFTVDVRADDRTLRELYLYPFERSV
AAGAWMVMAAYNSVGGTTMTENPLLAEPLKGSWGFDGVVVSDWTAVRSTEGAAAGTDLCM
PGPPLLWGEPLAAAVRAGTVPESAIDDKVRRILRFAERVGALGEPPRPAPVFDDDSARAL
VRRAAAEAMVLVHNDGVLPLRPGADIALLGPGAAEPRFMGGGSATVIPGHSSTPLEGLKA
VAPVTHTPGVRLTEGLVPVPLELVTDPDTGTAGVSLRFLDAAGEVFDTQHRTAGTLVLFG
DDSAARAAAIEVRARLRADTDGDWRIGVATVGQIRLTLDGEPVLDEQITPEGSDPLAALL
DPPQRAVTRTLAAGDEIDVHLRVETSSAIPGLGVIVGAMLGVARPQRPADAEFEAAVAAA
RAAEVAVVIVGTTEQIESEGVDRTTLRLPGRQDELVAAVAAVNPRTVVVVNSGAPVEMPW
SNDVAAVLLSWFPGQEFGGALTDILTGATEPGGRLPTTWPATMADAPILNTRPDTTGHLA
YNEGIHIGYRAWLRTARTPAYPFGHGIGYTTWELSNLEVDGHTISVTVRNTGTRTGKQVV
QVYLSRPTSTIDRPTRWLSAFEPITLPATHSHRLQIPLPQRSFEHWTPHGWTTEPGPFTA
HIGTSSTDLPLTATIE
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccggatcgaggagttgctggcacggctggatctgacggcgaaattgcggctc
atctccggggcggggatgttccggatggccggtgatccggcgatcgggctggccgagatg
ccgatctccgatggtccgtccggggtccgcggcgagcactgggacgagcgcgatccgtcg
gtgagcctgccctcgggcaccgcgctggccgccacctggaatcgcgaactggtcggggag
atcggcgcgctgattgcggcggaggcccggcgcaagggcgtgtacgcggtgctgggaccg
acgatcaatctgcatcgaaccccgctgggcggcaggcatttcgaatgcttctccgaggat
ccgatgctgaccgccgaactcgccgcggcctatgtgcggtcggtgcaggcgcacggcgtg
gccgcgtgcccgaaacactacgtggccaacgactccgagaccgaccgattcaccgtggac
gtgcgcgccgacgaccgcaccctgcgcgagctgtatctctatccgttcgagcgcagcgtg
gcggccggggcgtggatggtgatggccgcctacaactccgtcggtggcaccaccatgacc
gagaatccgctgctggccgaaccactcaagggcagttggggtttcgacggtgtggtggtc
tcggactggaccgccgtgcgcagcaccgagggcgcggcggcgggcaccgacctgtgcatg
cccggcccgccgctgctgtggggcgagccgctggcggccgccgtgcgcgcgggcaccgtg
ccggagtcggccatcgacgacaaggtccgccgcatcctgcgattcgccgaacgcgtcggc
gcgctcggcgaaccaccgcgcccggcaccggttttcgacgacgacagcgcccgagccctg
gtgcgccgggccgccgccgaggccatggtgctggtccacaacgacggggtgctgccgctg
cggcccggcgcggacatcgcgctcctgggcccgggcgcggccgagccacgcttcatgggc
ggcggcagcgccaccgtgatccccggccactccagcaccccgctcgagggcctgaaagcc
gttgcgccggtgacccatacgcccggcgtgcgactgaccgaggggctggtgccggtcccg
ctggaactggtcaccgaccccgacaccggcaccgccggagtgagcctgcgcttcctggac
gccgcaggagaggtgttcgacacccagcaccgcaccgcgggcactctcgttctgttcggc
gacgattcggccgcccgagccgccgcgatcgaggtgcgggcccggctgcgcgcagacacc
gacggcgactggcgcatcggggtggccaccgtcggacagatccggctcaccctcgacggc
gaaccggtactcgacgagcagatcacacccgagggctccgatccgctggccgccctgctg
gatccgccgcagcgcgcggtaacacgcaccctggcggcgggcgacgagatcgatgtgcac
ctgcgcgtcgaaacctcgtctgccatacccggtttgggcgtaatcgtcggcgcgatgctg
ggcgtcgcccgcccgcagcgcccggcggacgcggaattcgaggccgcggtggcggcggcc
cgcgcggccgaggtcgcggtggtgatcgtcggcaccaccgagcagatcgagagcgagggc
gtcgaccgcaccaccctgcggctgcccggccgccaggacgaactggtcgcggcggtggcg
gctgtgaacccgcgcacggtcgtggtggtgaattccggtgcccccgtggagatgccgtgg
agcaatgacgtagcggccgtgctcctgtcctggttccccggccaggaattcggcggcgcc
ctgaccgacatcctcaccggcgcaaccgaacccggcggccgcctccccaccacctggccc
gccaccatggccgacgcccccatcctgaacacccgccccgacaccaccggccacctcgcc
tacaacgagggcatacacatcggctaccgcgcctggctccgcaccgcccgcacccccgcc
tacccattcggccacggaatcggctacaccacatgggaattgagcaacctagaggtcgac
ggccacaccatatccgtgacagtccgcaacaccggcacccgcacaggcaaacaggtagtg
caggtctacctatcgcgcccaaccagcacaatcgaccgcccaacccgctggctatcagcc
ttcgaaccaatcaccctccccgccacccactcccaccgcctccaaatccccctaccacag
cgctcattcgaacattggaccccccacggctggaccaccgaaccaggcccattcacagcc
cacataggcacctcatccaccgacctaccactcacagcaaccatcgaatag

DBGET integrated database retrieval system