KEGG   Nocardia terpenica: CRH09_16630Help
Entry
CRH09_16630       CDS       T05168                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ntp  Nocardia terpenica
Pathway
ntp00620  Pyruvate metabolism
ntp00630  Glyoxylate and dicarboxylate metabolism
ntp01100  Metabolic pathways
ntp01110  Biosynthesis of secondary metabolites
ntp01120  Microbial metabolism in diverse environments
ntp01200  Carbon metabolism
Module
ntp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CRH09_16630
   00630 Glyoxylate and dicarboxylate metabolism
    CRH09_16630
Enzymes [BR:ntp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CRH09_16630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ATL67583
UniProt: A0A291RJ04
Position
complement(3737499..3739682)
Genome map
AA seq 727 aa AA seqDB search
MTERIQVGGLQVASVLHAFVENEALPGTGVDSAAFWSGAEAVINDLAPRNRALLAERDEI
QGKLDAWHAENPGTGYDKAAYKKFLTDIGYLRPEPADFRIGTENVDDEIATTAGPQLVVP
VMNARFAINAANARWGSLYDALYGTDAIPETGGAEKGSSYNRVRGDKVIEWARNFLDDAV
PLITGSHIGSQAYKIVDGELEVTLEDGTGIGLADASALVGYLGEPQSPTSILLRHNGLHI
EIQIDPASPIGSTDTAGVKDVVLESAVTTIMDFEDSVAAVDAEDKVLCYHNWLGLMKGDL
AEEVSKGGKTFTRTMNPDRVYKALDGSDLVLHGRSLLFVRNVGHLMTSDAILDSDGNEVP
EGILDGLITSLIAVHSLRGDARVTNSRKGSVYIVKPKMHGPDEVAFASELFGRIEDVLGL
PRNTLKVGIMDEERRTTVNLKACIAAAKDRAVFINTGFLDRTGDEIHTSMEAGAMVRKAE
MKKQQWILAYEDWNVDKGLETGLPHKAQIGKGMWAMPDLMHDMLEQKIGHPRAGATTAWV
PSPTAATLHATHYHLVDVFQRQTEIAKGGPRATVDQLLEIPLSPSTTWTADEIRNELDNN
SQSILGYVVRWIDHGVGCSKVPDINDVALMEDRATLRISSQLMANWLRHNIITTDQVIES
LERMAPVVDRQNAADPHYKPMAPDFASSVAFQAAKDLILEGTKQPNGYTEPILHRRRREA
KALAAKN
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcggattcaggtcggcgggctccaggttgccagcgttctgcacgcattcgtc
gagaatgaggcgcttcccggtaccggcgtagattccgccgcgttctggtccggtgccgag
gcggtcatcaacgacctcgccccgcgcaaccgcgccctgctggccgaacgcgacgagatc
cagggcaagctcgatgcctggcacgccgagaaccccggcaccggctacgacaaggctgcg
tacaagaagttcctcaccgacatcggctacctgcgcccggagccggcggacttccggatc
ggcaccgagaacgtcgacgacgagatcgccaccaccgcgggcccgcagctggtagtgccg
gtgatgaacgcccggttcgcgatcaacgccgcgaacgcccgctggggctcgctctacgac
gccctctacggcaccgacgccatccccgagaccggtggcgcggagaagggctcgagctac
aaccgggtgcgcggcgacaaggtcatcgagtgggcgcgcaacttcctcgacgacgcggtg
ccgctgatcaccggctcgcacatcggctcgcaggcgtacaagatcgtcgacggcgagctg
gaggtcaccctcgaggacggcaccggcatcgggctggccgacgcctccgcgctggtcggg
tacctgggtgagccgcagtcgccgacctcgatcctgctgcggcacaacggcctgcacatc
gagatccagatcgatccggcctcgccgatcgggtccaccgacaccgcgggcgtcaaggac
gtcgtgctggagtcggcggtcaccacgatcatggacttcgaggattcggtggccgcggtc
gacgccgaggacaaggtgctctgctaccacaactggctgggcctgatgaagggcgatctg
gccgaggaggtcagcaagggcggtaagaccttcacccgcaccatgaaccccgaccgggtg
tacaaggcgctcgacggttccgaccttgtgctgcacggccgttcgctgctgttcgtgcgc
aacgtgggtcacctgatgacctccgacgcgattctcgactccgacggtaacgaggtgccg
gagggcattctcgacggcctgatcacctcgctcatcgcggtgcactcgctgcgcggcgac
gcgcgggtcaccaactcgcgcaagggttcggtgtacatcgtgaagccgaagatgcacggc
ccggacgaggtggccttcgccagcgagctgttcggccgcatcgaggacgtgctcggcctg
ccgcgcaacaccctcaaggtcggcatcatggacgaggagcggcgcaccaccgtcaatctg
aaggcgtgcatcgcggcggcgaaggaccgggcggtgttcatcaacaccggcttcctggac
cgcaccggcgacgagatccacacctccatggaggccggcgccatggtgcgcaaggccgag
atgaagaagcagcagtggatcctggcctatgaggactggaacgtcgacaagggcctggag
accggcctcccacacaaggcgcagatcggtaagggcatgtgggccatgcccgatctgatg
cacgacatgctcgagcagaagatcggccacccccgcgccggcgccaccaccgcctgggtg
ccctcccccaccgccgccaccctgcacgccacccactaccacctggtggacgtgttccag
cggcagaccgaaatcgccaagggcggcccccgcgcaaccgtcgaccagctcctcgagatc
ccgctgtccccctcgaccacctggaccgcggacgaaatccgcaacgagctggacaacaac
tcccagtccatcctcggctacgtcgtccgctggatcgaccacggcgtcggctgctccaag
gtccccgacatcaacgacgtcgccctcatggaagaccgcgccaccctgcgcatctcgagc
cagctgatggcaaactggctgcgccacaacatcatcaccaccgaccaggtgatcgaaagc
ctggagcgcatggcccccgtggtcgaccgccaaaacgcagccgacccccactacaagccc
atggcaccggatttcgccagcagcgtagccttccaagccgccaaggacctcatcctggaa
ggcaccaaacagcccaacggttacacggaaccaatcctgcaccggcgtcggcgcgaggca
aaggccttggccgccaagaactga

DBGET integrated database retrieval system