KEGG   Nocardia terpenica: CRH09_22825Help
Entry
CRH09_22825       CDS       T05168                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ntp  Nocardia terpenica
Pathway
ntp00450  Selenocompound metabolism
ntp00970  Aminoacyl-tRNA biosynthesis
ntp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CRH09_22825
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CRH09_22825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ntp01007]
    CRH09_22825
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ntp03016]
    CRH09_22825
Enzymes [BR:ntp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CRH09_22825
Amino acid related enzymes [BR:ntp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CRH09_22825
Transfer RNA biogenesis [BR:ntp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CRH09_22825
 Prokaryotic type
   Other AARSs
    CRH09_22825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1e tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: ATL68601
UniProt: A0A291RLW2
Position
5159780..5161306
Genome map
AA seq 508 aa AA seqDB search
MTGPTIVISPAPTANGDLHLGHIAGPFLSADVYSRYARATGRKVVFGTGVQDTSTFVVTT
ARRLGTTPEALVRQSAKEVEATLDALGIAVDGFTGWEERFTSFVTRVIGGLRDAGRLRLR
PMRFPYAPRTGEYLVDGHVAGICPVCLAESCGGLCESCGHQVAGSELLEPRSTRDPDEPL
EFRDVEVLVLPAEEYRGKLRAHFDRIAGSLRPHAAQVIEEILSRPLPDFPVSYPLGWGIP
APGMPGQVVNPNAEPVAWTMYCSMLAAERAGLNPGSEDALWRREAGTEIVYFLGVDNVHP
FAISGLAMLLAFGDGYPLPTMFLTNEFYELDRSKFSTSRGHLVWGRELASQVPRDLIRFH
LASDSPEFQRTSFNRAELAELTRIRLVEPWNRVAERVDAWAGKGPLPVSGGSRNSAVRIV
QRFRSAYELPRFSVTRAATTLTQQLGRLDRSTLTGGDLCHEAEVLLRCAAPILIDLAAAL
PDTRIDGVAARDTVRPFRLPRLAGGGLR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtccgaccatcgtcatctcccccgctcccaccgccaacggcgatctgcacctg
gggcatatcgcgggcccgttcctgtccgccgacgtctactcccgttatgcgcgggcgacg
ggccgaaaggtggtgttcggcaccggagttcaggacacctccaccttcgtggtgaccacc
gcccgccgactgggcaccacgcccgaggcgctggtgcggcagtcggccaaggaggtcgag
gccaccctcgacgcgctgggcatcgccgtggacggcttcaccggctgggaggagcggttc
acctcgttcgtcacccgggtgatcggcgggctgcgcgatgccgggcgactccggttgcgc
cccatgcgttttccgtacgcgccccgcaccggggagtacctggtggacggccacgtggcg
ggcatctgcccggtgtgcctggccgagagctgcggcggcctgtgcgagagctgcgggcat
caggtcgcgggatcggaactgctggaaccgcgttcgacccgcgacccggacgagccgctg
gagttccgcgacgtcgaggtgctggtgctgcccgcggaggagtaccgcggcaagctgcgc
gcgcacttcgatcgcatcgccggatcgctgcgcccgcacgcggcccaggtgatcgaggag
atcctgtcgcgtccgctgccggacttcccggtcagctatccgctgggctggggcatcccg
gccccgggcatgcccgggcaggtggtgaacccgaacgccgaaccggtggcgtggaccatg
tactgctcgatgctggccgccgagcgggcggggctcaatcccgggtccgaggacgcgctg
tggcggcgcgaggccgggaccgagatcgtgtacttcctcggcgtggacaacgtccacccg
ttcgcgatctccggcctggccatgctgctcgccttcggcgacggctatccgctgccgacc
atgttcctcaccaacgagttctacgagctggaccggtccaagttctccaccagccgcggg
catctggtgtggggccgcgagctggcctcgcaggtgccgcgcgatctgatccggttccat
ctggcctccgacagcccggagttccagcggaccagcttcaatcgcgccgaactggccgag
ctgacccgaatccgcctggtggagccgtggaatcgggtcgcggaacgggtcgacgcctgg
gccgggaagggcccgctgccggtgtcgggcggctcgcgcaactccgcggtccgcatcgtg
cagcgcttccgctcggcctacgagctgccacgcttcagcgtcacccgggcggccaccacg
ctcacccagcagctgggccggttggaccggtccaccctcaccgggggcgacctctgccac
gaggcggaggtgctgttgcggtgcgccgcaccgattctcatcgatctggccgccgcgctg
ccggacacccggatcgacggcgtcgccgcccgcgacaccgtccgcccgttccggctgccg
aggctcgctggcggaggtctgagatga

DBGET integrated database retrieval system