KEGG   Nocardia terpenica: CRH09_26870Help
Entry
CRH09_26870       CDS       T05168                                 

Definition
(GenBank) acyl-CoA dehydrogenase
  KO
K21782  L-prolyl-PCP dehydrogenase [EC:1.3.8.14]
Organism
ntp  Nocardia terpenica
Pathway
ntp00333  Prodigiosin biosynthesis
ntp01100  Metabolic pathways
ntp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CRH09_26870
Enzymes [BR:ntp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.14  L-prolyl-[peptidyl-carrier protein] dehydrogenase
     CRH09_26870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 HpaB_N Acyl-CoA_ox_N
Motif
Other DBs
NCBI-ProteinID: ATL69260
UniProt: A0A291RPM5
Position
complement(6093561..6094718)
Genome map
AA seq 385 aa AA seqDB search
MNFDLPPETEAMCAALTAFARRDLAGGDCFDPGDFRRRWRLAGRQGIVGATVPEEYGGSG
LDAISAAALMEALGLGCPDTGFGFSVAAHLFACLMPIVEFGTAEQKQRWLPRLSSGEWIA
AHAITEPEAGSDVMNLSTRAERSGDHYILHGAKAFTTNAPVADVFIVQAATRPGGGFFGL
TAFVIESGTPGLRVGRPYDKVGLRGSPTADIHLEDCRVPLDSVLGGEGAGASVFSGSMKW
ERTCLFAVYLGAMRRVIDATIAFADERRQFGTAIGEFQAVAHRIVEMVSAFESARLLLMK
AACELSTGGNCEVSSGLAKVAVSEAAVRVGLDAVQLHGALGVTGGEAETLLRDALPARIF
SGTNEIQKNNIARALGLGRPRGPRR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgatctccctcccgaaaccgaggccatgtgtgcggcattgaccgccttcgcc
cgccgcgacctcgcaggcggcgactgcttcgatcccggcgacttccgccgccggtggcgg
ctggcgggcagacagggaatcgtcggcgccacggtacccgaggaatacggcggcagcggc
ttggacgctatctccgcggccgcgctcatggaagcactcggactgggttgtcccgacacc
ggtttcggcttttcggtggcggctcacctgttcgcctgcctcatgccgatcgtggaattc
ggcacggccgagcagaagcagcggtggctgccgcgattgagctccggcgaatggatcgcg
gcgcacgccatcaccgaacccgaggccggatcggatgtgatgaacctgtccacccgagcc
gagcgcagcggcgaccactacattctccacggcgccaaggcattcacgaccaacgcgccc
gtcgccgacgtcttcatcgtgcaggcggccacccggcccggcggcgggttcttcggcttg
accgccttcgtcatcgagtccggaacgccgggattgcgggtgggtcggccgtacgacaag
gtcgggctgcgcgggtcgccgacggccgatatccacctcgaggactgccgcgtaccgctg
gacagcgtgctcggcggcgaaggcgccggagccagcgtgttctccgggtcgatgaagtgg
gagcggacgtgcctgttcgcggtgtacctcggcgcgatgcggcgcgtgatcgacgccacc
atcgccttcgccgacgagcgccggcaattcggcacggccatcggcgaattccaggccgtc
gcgcaccgcatcgtcgagatggtctcggccttcgaatccgcccggttgctgctgatgaag
gccgcctgcgaactgtccaccggcggcaattgcgaggtgtcctcgggattggccaaggtg
gccgtcagcgaggccgcggtcagggtggggctggatgccgtccagctgcacggcgcgctc
ggcgtcaccggcggcgaggccgaaacgctgctgcgcgatgcgctcccggcgcgaatcttc
tccggtaccaacgagattcagaagaacaatatcgcgcgtgccctggggctgggccgcccg
cgcggcccgcggcgctga

DBGET integrated database retrieval system