KEGG   Nocardia terpenica: CRH09_30775Help
Entry
CRH09_30775       CDS       T05168                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ntp  Nocardia terpenica
Pathway
ntp00471  D-Glutamine and D-glutamate metabolism
ntp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CRH09_30775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ntp01011]
    CRH09_30775
Enzymes [BR:ntp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CRH09_30775
Peptidoglycan biosynthesis and degradation proteins [BR:ntp01011]
 Precursor biosynthesis
  Racemase
   CRH09_30775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ATL69908
UniProt: A0A291RRN4
Position
complement(6941309..6942187)
Genome map
AA seq 292 aa AA seqDB search
MTVTTVPRPALNVSQPGGNGNPGRDAPIGIFDSSFGGLTVARAILDQLPYEPILYFGDTA
RQPYGPRPIAQVRSYALECLDHLVDMGVKMLVIACNSASSAMLRDARERYDLPLVEVIRP
AVRRAVAATHNGRIGVICTQATKLAMSYEDSFAAAPHIQLITQACPRFVPFVEAGVTSGD
ELLNAAFEYLEPIQAAGVDTLILGCTHYPLLTGVISYVMGERTTLISSAEETAKNVYRQL
AELNLIRDKAAETPQHQFLTTGNPHQFRTLGRRFLGHEMELVESVFLSGARL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgacaacggtgccgaggccggcgttgaacgtatcgcagcccggcgggaatggc
aatcccggccgagacgcgccgatcggcatcttcgactccagcttcggcggactcacggtc
gccagggcaatcctcgaccaactgccatatgagccgatcctctacttcggtgacaccgcc
cgacaaccatacggccccaggccgatcgcgcaggtacggtcgtatgcgctcgaatgcctc
gaccacctggtcgatatgggcgtgaagatgctcgtcatcgcgtgcaactcggcgagttcg
gcgatgctacgggacgcgcgcgagcgatacgatctaccgctggtcgaagttatccgaccg
gcagtccgccgagcggtcgccgcgacccacaatgggcgcattggcgtcatatgtacgcaa
gccaccaagctcgcgatgtcctacgaagactcgttcgcagcggcaccccacatccagctg
attacgcaggcatgcccgcgattcgtccccttcgtggaagctggagtaaccagtggtgat
gaattgctcaacgctgcattcgaatatttagagccgatacaggccgctggggtcgatacg
cttatactcggttgcacgcattaccccttgctcaccggcgtgatctcttatgtcatgggc
gagcggacgacgctgatctccagcgctgaggagaccgccaagaatgtctaccggcagttg
gcagaactgaatttgatccgtgacaaagcagcggagactccacagcaccagttcctgacc
accgggaaccctcatcaatttcgcacactgggccgccggtttctcggacacgaaatggaa
ttggtggagtcggtcttcttgtctggcgctcggctttga

DBGET integrated database retrieval system