KEGG   Nocardia terpenica: CRH09_32985Help
Entry
CRH09_32985       CDS       T05168                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
ntp  Nocardia terpenica
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CRH09_32985
Enzymes [BR:ntp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CRH09_32985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ATL72289
UniProt: A0A291RYD3
Position
7441387..7442250
Genome map
AA seq 287 aa AA seqDB search
MAALEAEAVGDPAAAAAAKRSVDLAVVQFAPHTDKSANLAMLREHVRAAAEHGARVVIAP
EYTMFAVSRLDQRAVAAAEPLTGPFVGELRGLAAEFGVHLVAGVVEAPGGAETGRVYNTL
VVTDPDAQLVAVYRKVHLYDAFGGGESAVLLPGPIEEPATFTVGDVTFGLQTCFDVRFPE
GCRRVATAGAHVLVVPAQWIPGPLKVEQWRTLLHARAIENTMYVAAADHAAPRGAGTSTI
VDPAGSVLAELGDQTGIATARIDLDHLDQIRSTNPSLSLRRFTVEPK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgctcgaggcggaggcggtgggcgacccggcggccgccgcggcggcgaagcgg
tcggtcgacctcgccgtggtccagttcgcgccccacaccgacaagagcgccaacctcgcg
atgctgcgcgagcacgtgcgcgccgccgccgagcacggggcgcgggtggtgatcgcgccg
gagtacacgatgttcgcggtgagccggttggatcagcgggcggtggccgcggccgagccg
ctgaccggtccgttcgtcggcgaattacgcggtctcgcggccgaattcggggtgcacctg
gtggcgggcgtggtggaggcgccgggcggcgcggagaccgggcgcgtctacaacacgctg
gtggtgaccgatccggacgcgcagctggtggcggtctaccgcaaggtgcacctgtacgac
gcgttcgggggcggtgagtccgcagtgctgctgccggggccgatcgaggaaccggccacg
ttcaccgtcggcgacgtgacgttcggcctgcagacctgcttcgacgtgcgattcccggag
ggctgccgcagggtggccaccgcgggtgcgcacgtgctggtcgttccggcgcaatggatt
ccgggcccgctgaaggtggagcagtggcggacgctgctgcacgcccgggccatcgagaac
accatgtacgtggccgcggccgatcacgccgcaccccgcggggcgggcacgtcgacgatc
gtcgatcccgccggttccgtgctcgccgaactgggcgaccagaccggcatcgccaccgcg
cgcatcgacctcgatcacctggatcagatccgcagcaccaatccgagcctgtcgctgcgc
cggttcaccgtcgagccgaagtaa

DBGET integrated database retrieval system