KEGG   Nocardia terpenica: CRH09_39300Help
Entry
CRH09_39300       CDS       T05168                                 

Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
ntp  Nocardia terpenica
Pathway
ntp00310  Lysine degradation
ntp01100  Metabolic pathways
ntp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CRH09_39300
Enzymes [BR:ntp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     CRH09_39300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 NAD_binding_8 Amino_oxidase NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ATL72468
UniProt: A0A291RYW9
Position
8787125..8788318
Genome map
AA seq 397 aa AA seqDB search
MPLVYDYCVVGGGIVGVATAARILERWPGVGVLVVEKEGRVGVHQSGHNSGVVHSGIYYE
PGSLKARLCREGARWTKEFAVGEGIPYRECGKLLVATDLEERRRMRGLYERAVANGVGVE
LLDAGELKRREPRIAGVGALFVPGTGIVDYGRVTEALAGRVRAAGGEFVLGAEVTAVEED
SDGVTVAGPAGSWRARRMVACAGLQADRVARMAGVAVGLRIVPFRGEYYRLPPARSDLVS
TLIYPIPNPELPFLGVHLSPTIDGELTVGPNAVLGLAREGYRKGSIDLRDAREVLGYRGF
HRVAAANVRTGLRELRNSVFKRGYLAECRRYCPELTIADLLPRPAGIRAQAVLPDGTLVH
DFLIERTERSVHVLNAPSPAATSALPIAEHIVGQLDN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ctgcctctcgtgtacgactactgcgttgttggtggtgggattgttggggtggctactgct
gctcggattttggagcggtggccgggggtgggggtgttggtggtggagaaggaggggcgg
gtgggggtgcatcagagtgggcataacagtggggttgttcattctgggatttattacgag
ccggggagtttgaaggcgcggttgtgtcgggagggggcgcggtggaccaaggagtttgct
gtgggggaggggattccgtatcgggagtgtgggaagttgttggtggcaacggatttggag
gagcggaggcggatgagggggctgtatgagcgggcggtggccaatggggtgggggtggag
ttgctggatgcgggggagttgaagcggcgggagcctcggattgcgggggtcggggcgttg
ttcgtgccggggacggggattgtcgattacgggcgggtgaccgaggcgttggcggggcgg
gtacgggcggcggggggtgagttcgtgctgggggcggaggttaccgctgtcgaggaggat
tccgacggggtgacggtggcggggcccgcggggtcgtggcgggcgcggcggatggtggcg
tgcgcggggttgcaggccgatcgggtggcgcggatggcgggggtggcggtcgggctgcgg
atcgtgccgtttcggggggagtactaccgattgccgcctgcgcgaagcgatctggtgagc
acgctcatctatccgatcccgaatccggagctgccgtttctgggcgtgcatctgagcccg
accatcgacggtgagctgaccgtggggccgaacgcggtgctggggctggcgcgcgagggc
taccgcaagggcagcatcgatctgcgcgatgcccgagaggtgctgggctaccggggtttt
caccgggtggcggcggccaatgtgcgaaccgggctgcgggagctgcgcaattcggtgttc
aagcgcggttatctggccgaatgccgcaggtactgcccggaattgacgatcgcggatctg
ttgccgcgtccggccgggattcgcgcccaggcggtgctgcccgacggtaccctcgtgcac
gacttcctcatcgaacgcaccgagcgctcggtgcacgtgctcaacgcgccgtcccccgcg
gccacctccgcgctaccgatcgccgagcacatcgtcgggcaattggacaactga

DBGET integrated database retrieval system