KEGG   Novibacillus thermophilus: B0W44_00570Help
Entry
B0W44_00570       CDS       T04694                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
ntr  Novibacillus thermophilus
Pathway
ntr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ntr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B0W44_00570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ntr01007]
    B0W44_00570
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ntr03016]
    B0W44_00570
Enzymes [BR:ntr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     B0W44_00570
Amino acid related enzymes [BR:ntr01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   B0W44_00570
Transfer RNA biogenesis [BR:ntr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    B0W44_00570
 Prokaryotic Type
    B0W44_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1f IFT46_B_C
Motif
Other DBs
NCBI-ProteinID: AQS54508
UniProt: A0A1U9K397
Position
105115..106515
Genome map
AA seq 466 aa AA seqDB search
MGVKLFNTLTREKETFKTIEPGKVRMYVCGPTVYNHIHIGNARPFVVFDVVRRYLKYKGY
DVKYVQNFTDVDDKLIRAAREEGSTVPEIAERYIDAYFDAVDKLGVHRADVHPRVTENMP
DIIESIRQLLDKGVAYESEQHVYFRARSQKDYGKLSHQSPDELKAGARVEVNEAKEDPLD
FVLWKPAKPGEIAWDSPWGKGRPGWHIECSVMSRKFLGDTIDIHAGGSDLTFPHHENEIA
QSEALTGQKPFARYWLHNGFINMDNEKMSKSLGNVVRVNELLEQFSPLPIRYVLLSAHYR
QPLNFSQALIEQAENAVERIHTCAANLKHRLSASRSEKVEPDVERTLQALSEKFEQAMDD
DFNTPNAMSVVFKAVREANEFLNRPVVYRESVEAYLAWFDTYAEEILGLLPQDESLLDSD
IERLIAERDRARKERDFAKADSIRDHLRQKGIILEDTPQGVRWRRK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgaaactgttcaacacgttgactagagagaaagagacattcaagacgattgaa
ccgggaaaagttcgcatgtacgtctgcggtccgactgtgtacaaccatattcacatcggg
aacgcacggccgttcgtcgtattcgacgttgtacggcggtatttgaaatacaaagggtat
gacgtcaagtacgtgcaaaactttaccgatgtcgatgacaagctgatccgcgccgcccgt
gaagaaggaagtacggttccggagatcgcagagcggtacattgacgcctactttgatgcg
gtcgacaaactcggcgtgcaccgtgccgacgttcatccgcgcgtgacggaaaatatgccg
gacatcatcgagagcatccgacaacttttggacaaaggagtcgcttatgaatcggaacag
cacgtctactttcgcgcccgaagtcagaaggattacggcaaactgtcacaccagtcaccg
gacgagttaaaggcgggagctcgtgtcgaagtgaacgaggcgaaggaagacccgctggac
tttgtactgtggaaaccggccaagccgggagaaattgcgtgggacagtccgtgggggaag
gggcgcccgggatggcacattgagtgttccgtcatgagtcggaaatttctgggagacacg
attgacatccacgcgggcggcagtgatttaacgtttccgcaccacgaaaatgaaatcgcc
cagagtgaagccctcaccggccaaaagccgttcgcccgctactggctgcataacgggttt
attaacatggacaacgaaaaaatgtctaagtccctcgggaacgtcgtgcgggtcaacgag
ttgctggagcagttttcgccgcttcccattcgctatgtcttgttgtcagcacactaccgt
cagccccttaatttcagccaggcgctcattgaacaagcggaaaatgctgttgaacgcatt
cacacctgcgctgccaatttgaaacaccgtctgtccgcttcgcgttctgaaaaggtagaa
ccagatgtggaacgcactttacaggcgctgtcagagaagtttgaacaagcgatggacgac
gacttcaacactcccaacgccatgtccgtcgtgtttaaagcggtgcgcgaagcgaatgag
tttttaaaccgtcccgtcgtttaccgcgaatcggtagaagcgtacctggcgtggtttgac
acgtatgcagaagagatactcgggctgctcccgcaagatgaatcgcttttggacagcgac
atcgaacggttgattgcggagcgcgatcgggcgcgcaaagagcgagattttgcaaaagcg
gacagcatacgcgatcacttgaggcagaagggcatcattctcgaagacacaccgcaaggt
gtacggtggcgtcgcaaatga

DBGET integrated database retrieval system