KEGG   Novibacillus thermophilus: B0W44_06045Help
Entry
B0W44_06045       CDS       T04694                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
ntr  Novibacillus thermophilus
Pathway
ntr00310  Lysine degradation
ntr01100  Metabolic pathways
ntr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ntr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    B0W44_06045
Enzymes [BR:ntr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     B0W44_06045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Pyr_redox_3 HI0933_like Mqo Trp_halogenase Thi4 FAD_binding_2 Pyr_redox_2 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AQS55413
UniProt: A0A1U9K5W5
Position
1215534..1216757
Genome map
AA seq 407 aa AA seqDB search
MYDFTVIGGGIVGLATAYHLVHAYPQAAVLVLEKEQSLGLHQTGNNSGVIHSGIYYKPGS
LKARFATEGNRRIVEFCQKYRIPYEQCGKVIVATAEAERPLLHTLYERGIANGLTLRKLT
PNELQEREPHVHGLEAIFVPSTGIVDYVQVLNTLARVVEEKGGEIRVGTRVEGMEEEAEF
IDIGTNAGTVQTRFAINCAGLFSDRVARMTGLSLGMKIVPFRGEYYELKPEKRHLVKHLV
YPVPNPAFPFLGVHFTRMVDGSVHVGPNAVLSLKREGYRKGDVNLRDSWDVLTYPAFWKI
AFRYMSVGLSEMVRSYSQRAFVRSIQRFIPEITADDLVPAPAGVRAQALTRDGRLVDDFI
IVRSKRAVHVCNAPSPAATASLVIGEHIVSLMAESYTSHKKRVTKSV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgactttacggtcatcggcggggggattgtcggtcttgcgacagcgtaccattta
gttcacgcgtacccgcaagcagccgtcctcgtcttggagaaagaacagtccctcggtttg
catcagacgggaaacaacagcggtgtcatccactctggcatatactacaaaccggggagt
ttaaaagcgcggtttgcaacggaaggcaaccggaggatagttgagttttgccaaaaatac
cgcatcccgtacgaacagtgcggcaaagtgattgtcgcgacggcagaagccgaacgcccc
cttttacacactctgtacgagcggggaatcgccaacggactgacgttacgcaaactgacc
ccgaacgaattgcaggagagggaaccgcatgtacacgggctggaagcgatattcgtgccg
agtaccggcatcgttgactatgtgcaagtgttgaatacgttagcgcgcgtcgtggaagaa
aaaggcggagagattcgggtggggacccgagttgaaggcatggaagaggaggctgagttt
atagacatagggacgaatgccggaacagtgcagacgcgttttgccatcaactgtgccggc
ctgttcagcgaccgtgtcgcccgtatgaccggcctttcccttggaatgaagatcgttcct
ttccgcggcgagtactacgagttgaagcccgagaaacgacatctggtgaagcatttggtc
taccccgtgccgaatccggcgtttccgttccttggcgttcactttacgcgaatggtggat
ggctccgtccacgtcggtccgaatgcggtgctcagtttgaaacgggaggggtaccgcaaa
ggggacgtgaacctgcgggacagttgggatgtgttgacgtaccccgctttttggaaaatt
gcgtttaggtacatgtcagtcggcttgagcgaaatggtgcggtcttatagtcaacgagcg
tttgtgcggagcatccaacggtttattccggaaataaccgccgacgatctcgtcccggca
ccggcaggagtgcgggcgcaggcgttgacccgggacggacggctcgtcgatgacttcatc
atcgtgaggtctaagagggcggtacacgtgtgcaatgcgccttctccggcggctactgct
tccctcgtcatcggcgagcacatcgtcagtctcatggctgagtcgtacacttcccataaa
aaacgtgtcacaaaatctgtctga

DBGET integrated database retrieval system