KEGG   Novibacillus thermophilus: B0W44_17190Help
Entry
B0W44_17190       CDS       T04694                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ntr  Novibacillus thermophilus
Pathway
ntr00071  Fatty acid degradation
ntr00072  Synthesis and degradation of ketone bodies
ntr00280  Valine, leucine and isoleucine degradation
ntr00310  Lysine degradation
ntr00362  Benzoate degradation
ntr00380  Tryptophan metabolism
ntr00620  Pyruvate metabolism
ntr00630  Glyoxylate and dicarboxylate metabolism
ntr00640  Propanoate metabolism
ntr00650  Butanoate metabolism
ntr00900  Terpenoid backbone biosynthesis
ntr01100  Metabolic pathways
ntr01110  Biosynthesis of secondary metabolites
ntr01120  Microbial metabolism in diverse environments
ntr01130  Biosynthesis of antibiotics
ntr01200  Carbon metabolism
ntr01212  Fatty acid metabolism
ntr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ntr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B0W44_17190
   00630 Glyoxylate and dicarboxylate metabolism
    B0W44_17190
   00640 Propanoate metabolism
    B0W44_17190
   00650 Butanoate metabolism
    B0W44_17190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B0W44_17190
   00072 Synthesis and degradation of ketone bodies
    B0W44_17190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B0W44_17190
   00310 Lysine degradation
    B0W44_17190
   00380 Tryptophan metabolism
    B0W44_17190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B0W44_17190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B0W44_17190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B0W44_17190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ntr04147]
    B0W44_17190
Enzymes [BR:ntr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B0W44_17190
Exosome [BR:ntr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B0W44_17190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AQS57221
UniProt: A0A1U9KB47
Position
complement(3520172..3521356)
Genome map
AA seq 394 aa AA seqDB search
MKRTVIVDGVRTPIGKFGGVFKDVPAVDLGAHAISEALKRSHVPPEEVEHVVMGMVLQGG
AGQIPSRQAARKAGLPWDVTSETLNKVCASGLRSVTLAEQIIRSGDADVIVAGGMESMSQ
APYILPQARWGHRMGHVETRDLMVHDGLWCAFDDVHMAVHGSRVAQEYGVDRKSQDEWAL
RSHERAIAAIASGKMGEEIVPFTVRQRKGAQRVDTDEAPRSDTSLEKLAQLPPIFDEEGT
VTAGNAPGVNDGAGAFVLASAEKAEALGLRPKAEILGHATVGAEAPYLATVPALAAQKLL
KKTGYALDDIHLFEINEAFAAVTLTSQKLLGIDSEKLNVNGGAVALGHPIGASGARIVLT
LMYELRRRGGGLGIAAICSGAAQGDAVLIRVDGS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggacagtcatcgtagacggggtgcgaacgccgattggcaaattcggcggggtg
ttcaaggatgtacctgcagtcgatctcggggctcacgccataagcgaggcgttaaagcga
tctcatgttcccccggaagaagtggagcacgtcgtgatggggatggtgttgcaaggggga
gctggacagatcccgtcccgacaggcagcgcgcaaagctgggctcccttgggacgtgacg
tcggaaacgttgaacaaagtgtgcgcctccgggttgagaagcgtcacgctagccgaacaa
atcatccgcagcggggacgctgacgtcatcgtggctggcgggatggaaagcatgagccaa
gcgccgtacatactgccacaggcgcggtgggggcacaggatggggcacgttgagacgaga
gacttaatggttcacgacgggttgtggtgtgcgttcgacgacgtgcacatggctgtacat
ggaagtcgagtggcccaggagtacggcgtcgaccggaaatctcaagacgagtgggcgctg
cgcagtcacgagcgggccatcgctgcgatcgcgagcggcaagatgggggaagaaattgtg
ccgtttaccgtgcgccaaagaaaaggggctcaacgcgtggacaccgacgaagcgccgcgc
agcgacacgtcactggaaaagctggcccaattgccccccattttcgacgaagaagggacc
gtgactgctggcaacgctccgggggtcaacgacggagcgggtgcattcgtcctcgcatcg
gcggaaaaggccgaggcgttgggattgcgtccgaaggctgaaattttagggcacgccacg
gttggggccgaagccccttatttggccactgttccagccctcgccgctcaaaaactgttg
aaaaagacaggttatgccctggacgacatccatttgtttgaaatcaacgaagcgtttgct
gcagtgacgttgacgagtcaaaaacttctcgggatcgacagtgagaaattaaacgtcaac
ggtggagctgtcgccttgggacatccgatcggggccagcggcgcccgcattgtactcacc
ttgatgtatgaactgagacgccgcggcggtggtctcggaatcgccgccatttgcagtggg
gctgcccaaggggatgcggttctgattcgtgtggacggaagttaa

DBGET integrated database retrieval system