KEGG   Candidatus Nitrosoglobus terrae: TAO_0064Help
Entry
TAO_0064          CDS       T05173                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
ntt  Candidatus Nitrosoglobus terrae
Pathway
ntt00770  Pantothenate and CoA biosynthesis
ntt01100  Metabolic pathways
Module
ntt_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ntt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TAO_0064
Enzymes [BR:ntt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     TAO_0064
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     TAO_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Herpes_UL14
Motif
Other DBs
NCBI-ProteinID: BAW79434
UniProt: A0A1Q2SJY9
Position
60190..61404
Genome map
AA seq 404 aa AA seqDB search
MTTLNPLKSKRILLGVSGSIAAYKAADLVRKLREAEVEVRVVMTAAAQRFVSPLTFQALS
GKPVHTELMDLAQEAAMGHITLARWADLLLIAPASANFLARLAQGLADDLLAAVCLATSA
PVAVIPSMNQQMWQAAATQNNIATLHSRGVQVWGPARGSQACGEWGLGRMLESQDLLERV
IRSFTAPCLAGRSVLVTAGPTRESLDPVRFLSNRSSGKMGYALAAAAAEAGARVVLISGP
VALDPPLGVERFQVESAQQMYTTTLAQITAVDILIGCAAVADYRPVKQVEQKIKKTDQNL
ILVLEQSPDILEQVGRLANKPFMVGFAAETDNLEANAECKLKAKNLDLIAANSIKNGQGF
DMDENTLTVIWSGGKAELSTAPKIHLARMLIKLIAKHYDAKNPA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgactacccttaatcctttaaaaagtaagcgtattttattaggggtaagtggtagtatt
gcggcctataaagctgctgatctcgttcgtaagttacgtgaagcagaggttgaagtgagg
gttgtcatgactgccgctgctcaaagatttgtaagcccgcttacttttcaagcgttaagc
ggaaagcctgttcatacggaacttatggatttggctcaagaggcggcaatggggcatatt
acgctagcccgctgggcagatctactgttaatagcgccggcctcagctaattttttggcg
aggttggctcaaggtttagctgatgatttactggctgctgtatgcctagctacttctgct
cctgtagcggtaatacctagtatgaatcagcaaatgtggcaagctgcggcaacacagaac
aatattgcaactttacattcccgaggggtgcaagtgtgggggcctgcgagggggagtcag
gcttgtggtgaatggggtttagggcgaatgctagaatcccaagatctattagaaagggta
attagatcctttaccgcgccttgtttagctggtagatctgtattggtaacggctggacct
actcgagaatctttagatccggtgcggtttttaagcaatcgaagctccggcaaaatgggc
tacgcgctagctgctgctgccgctgaagctggggctcgagtggtgctgattagcgggccg
gtcgcccttgatccaccactaggcgtagaacgattccaagtagaaagcgcccagcaaatg
tatacgactacgcttgctcaaataaccgcggtagatattttgatcggttgtgctgcagtg
gctgattaccgacccgttaagcaggtagagcaaaaaataaaaaaaacagaccaaaatttg
atcttagtgctggagcaaagcccagatattcttgaacaggtaggaagattggctaataag
ccttttatggttggatttgcggcagaaactgacaatcttgaagctaatgccgaatgtaag
cttaaggctaaaaaccttgatttgattgctgctaacagtattaaaaatgggcaaggcttt
gatatggacgagaacactttaacggtaatatggtctggtggtaaagcagaactatctaca
gctcctaagatccacttagctcggatgctaattaaattaattgcaaaacattatgatgcc
aaaaatccagcttaa

DBGET integrated database retrieval system