KEGG   Candidatus Nitrosoglobus terrae: TAO_0994Help
Entry
TAO_0994          CDS       T05173                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ntt  Candidatus Nitrosoglobus terrae
Pathway
ntt00450  Selenocompound metabolism
ntt00970  Aminoacyl-tRNA biosynthesis
ntt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ntt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TAO_0994
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TAO_0994
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ntt01007]
    TAO_0994
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ntt03016]
    TAO_0994
Enzymes [BR:ntt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TAO_0994
Amino acid related enzymes [BR:ntt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TAO_0994
Transfer RNA biogenesis [BR:ntt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TAO_0994
 Prokaryotic type
   Other AARSs
    TAO_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: BAW80364
UniProt: A0A1Q2SMK5
Position
complement(1054363..1056396)
Genome map
AA seq 677 aa AA seqDB search
MPRSRKILVTSALPYANGPIHLGHLVEYIQTDIWVRFQRMRNHECYYVCADDAHGTPIML
RAQQEGITPEALIQQFSIEHQADFADFSISFDNYYSTHSPENCALSEAIYLANQAKGHIT
TRVIKQAYDPIKRIFLPDRFIRGTCPRCAAPDQYGDSCEICGATYSPTDLKEAVSVLSGM
PPVERESVHYFFKLSHFESLLRSWTGEDGHLQHEMANKLNEWFETGLQDWDISRDAPYFG
FPIPDTTDKYFYVWLDAPIGYLASFKNLCERKGLDFDAFMTPESTAELYHFIGKDILYFH
ALFWPAMLHSAGFRLPTAIFAHGFLTVNGQKMSKSRGTFIKARTYLDHLNPEYLRYYFAT
KLSSGIEDLDLNFEDFMARVNADLVGKIVNIASRCAGFINKHFSNQLSNRLINEDLFTEF
AIANDRLAQAYENREFGYAMREIMALADKANRYIDNHKPWVVIKNPERGQEVQEICTLGL
NLFRQLILYLKPVLPMTAKKTESFLNCKPLTWVDAHVPLLNHAIHHFEPLLVRVEKAKIN
TMLEDSKEHLKKNENFPQSSTFLAANPIAETIQFEDFAKLDLRVAKILKAEAIEGAEKLL
RLELEIGGETRQVFAGIKAAYAPENLVGRLTVMIANLAPRKMRFGVSEGMVLAAGSGGKE
IYLLNPDEGAQAGMRVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgccacgttcacgtaagatacttgttactagcgcccttccttacgctaatggccccata
catctaggccacttagtagagtacatccaaacagatatttgggtacgttttcaacgtatg
cgaaatcatgagtgttattatgtctgcgctgacgatgcgcatggtacccccattatgctg
cgggcccaacaagaagggataactcctgaggcattaattcaacaatttagcatagaacac
caagctgattttgcggatttttcaattagttttgataattactacagcacccactcacca
gaaaattgtgctttatcggaggctatttatctagctaatcaagcaaaagggcacattact
acgcgtgtcattaagcaagcttatgaccctattaaaaggatatttttacccgatcgattt
attcgcggtacctgtccccgttgtgcagctcctgatcagtatggagatagttgtgaaatt
tgcggagcaacttactctcccactgatttgaaagaggctgtctcagtgctctctggtatg
ccaccggtagaacgagaatcagtacattacttctttaaattaagtcattttgagtcctta
ttaagatcttggacgggagaagatggtcatcttcagcacgaaatggcaaataaattaaac
gaatggtttgagactgggttacaagactgggatatctctcgcgatgccccttattttggc
tttccaattcctgatactaccgataaatacttctatgtttggttagacgcacccattggg
tatctagcaagctttaagaatctgtgtgagcgtaaaggacttgattttgatgcttttatg
accccagaaagtaccgctgagctttatcattttatcggcaaagatatcctttattttcat
gctttattctggcctgctatgctccacagtgctggttttcgtttacccacggctattttt
gcccatggttttttaacggtcaatggccagaaaatgtccaaatctcggggaacttttatt
aaagctcgtacttatttagatcatttaaacccagaatatttacgttattatttcgccacc
aagcttagtagtggaattgaagatttggatcttaatttcgaagattttatggctcgagtc
aatgcggatcttgtgggtaagatagtaaacatcgctagccgctgtgcaggctttattaat
aaacattttagtaaccagctttcaaatcgcttaattaacgaggacttgtttacagaattt
gcaatagccaatgatcgattagcccaagcttatgaaaatcgagaatttggctatgcaatg
cgggaaattatggcacttgcggataaagccaatcgctatattgataatcataaaccttgg
gtagtcattaaaaatccagagcgagggcaagaagtccaagaaatttgtaccttgggcctt
aacctctttcggcaattaatactctaccttaaaccggttctgcctatgacggcaaaaaaa
accgagagcttcctcaattgcaagcctcttacttgggttgatgctcacgtacctttgctt
aatcatgctattcatcattttgaacctctgctggttcgtgtggaaaaagctaaaattaat
actatgcttgaagattctaaagaacacttgaaaaaaaatgaaaattttcctcagtccagc
accttcctagctgcaaaccctattgctgaaacaattcaatttgaagattttgctaagctc
gatcttagagtggctaaaatattaaaagcagaagcaatagaaggcgctgaaaagctattg
cgcttggagttagagataggcggtgagacccgccaagtttttgctggcattaaagccgct
tatgcgcctgagaatctagtaggccgcctaacggttatgattgccaatttagcaccccga
aaaatgcgttttggagtctctgaaggtatggtgttggcagctggctccggcggtaaagag
atttatttactcaatccagatgaaggtgctcaggcagggatgcgggtaaagtaa

DBGET integrated database retrieval system