KEGG   Candidatus Nitrosoglobus terrae: TAO_1413Help
Entry
TAO_1413          CDS       T05173                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ntt  Candidatus Nitrosoglobus terrae
Pathway
ntt00230  Purine metabolism
ntt00240  Pyrimidine metabolism
ntt01100  Metabolic pathways
ntt01110  Biosynthesis of secondary metabolites
ntt01130  Biosynthesis of antibiotics
Module
ntt_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ntt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ntt_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ntt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TAO_1413
   00240 Pyrimidine metabolism
    TAO_1413
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ntt04131]
    TAO_1413
Enzymes [BR:ntt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     TAO_1413
Membrane trafficking [BR:ntt04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    TAO_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: BAW80783
UniProt: A0A1Q2SNV4
Position
complement(1563100..1563531)
Genome map
AA seq 143 aa AA seqDB search
MAIERTLSIIKPDAVAKNVIGEIYTRFEKAGLRIVAARMLHLTEAQAQKFYAVHKDRPFY
HDLVKFMISGPIMVQVIEGENAIIKNRDLMGATNPKEAAAGTIRADFAENIDANAVHGSD
GPETAKSEIAFFFKSEEICSCAG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgagcgcacactttccatcattaaacctgatgctgtagctaaaaatgtaatt
ggggaaatctatacgcgttttgagaaggcgggtttacgaattgtggcagctcgaatgctg
cacttgactgaggcgcaggcacagaaattttatgctgttcataaagatcggcctttttat
catgatttagttaagtttatgatttccggaccgataatggttcaggtgatagaaggtgag
aatgcgattatcaaaaaccgagatcttatgggtgcaaccaacccaaaagaagccgctgcg
ggaaccattcgcgctgattttgctgagaatatagacgcgaacgctgttcatggatctgat
gggccagagacggctaagtctgagattgcttttttctttaagtctgaagagatttgttct
tgtgcaggctaa

DBGET integrated database retrieval system