KEGG   Nitrosomonas ureae: ATY38_00795Help
Entry
ATY38_00795       CDS       T04188                                 

Definition
(GenBank) class II aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
nur  Nitrosomonas ureae
Pathway
nur00051  Fructose and mannose metabolism
nur01100  Metabolic pathways
nur01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ATY38_00795
Enzymes [BR:nur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ATY38_00795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ALQ49907
UniProt: A0A1H2DPS9
Position
complement(148605..149390)
Genome map
AA seq 261 aa AA seqDB search
MSNDTFNLGKEQLIKQSLKQMDKHLQGANYTPAQKLALTCRILFDNGHDSGLAGQITARG
GQPGTYLTQRLGFGFDEICASNLLLVNEDLEVLQGDGMANPANRFHSWLYRARPDVQCII
HTHAVHTAALSMLEVPLEISHMDNCVLYDDVAFLPRWPGVPVGNDEGEMISKAIGNRHAL
LLAHHGLLIASSSIEEGCILALAFERAARMHLLAACAGKIQPIDPALGREARDWILRGQR
STVAFAYYARRTLRSGVDCLK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgacactttcaacttaggcaaagaacaattgattaaacaatcgctgaagcaa
atggataagcatttgcaaggcgcaaattatacgccggcacaaaaattggcattgacctgc
agaattttgtttgataatggacatgattcaggattagccggacaaattaccgcacgtggt
gggcaaccgggtacttatttgacgcaacggctgggatttggctttgacgaaatttgtgcc
agcaatttattgctcgtcaatgaagatttggaagtgctgcaaggcgacggcatggccaat
ccggccaatcgattccattcctggctgtatcgcgcgcgccctgatgtgcaatgcattatt
catacgcacgccgtacataccgctgcgctgagcatgcttgaagtgccgctggaaatatcg
cacatggataattgcgtgctctatgacgatgtggctttcttaccccggtggccaggtgtt
ccggtcggcaatgatgaaggcgaaatgatttccaaggctatcggtaacagacatgcctta
ttgttagcccatcacggtttattgatcgccagctcgagtattgaagaaggatgcatactg
gcacttgcttttgaacgggcggcgcgcatgcatttgctggccgcctgcgcgggtaagatt
cagccgattgatcccgctttagggcgtgaagcacgcgactggattctgcgcggacaacgt
agtactgtggcttttgcatactatgcacgacgtactttaagaagtggggtggattgtctg
aagtag

DBGET integrated database retrieval system