KEGG   Nitrosomonas ureae: ATY38_03325Help
Entry
ATY38_03325       CDS       T04188                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nur  Nitrosomonas ureae
Pathway
nur00071  Fatty acid degradation
nur00280  Valine, leucine and isoleucine degradation
nur00310  Lysine degradation
nur00362  Benzoate degradation
nur00380  Tryptophan metabolism
nur00620  Pyruvate metabolism
nur00630  Glyoxylate and dicarboxylate metabolism
nur00640  Propanoate metabolism
nur00650  Butanoate metabolism
nur00900  Terpenoid backbone biosynthesis
nur01100  Metabolic pathways
nur01110  Biosynthesis of secondary metabolites
nur01120  Microbial metabolism in diverse environments
nur01130  Biosynthesis of antibiotics
nur01200  Carbon metabolism
nur01212  Fatty acid metabolism
nur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATY38_03325
   00630 Glyoxylate and dicarboxylate metabolism
    ATY38_03325
   00640 Propanoate metabolism
    ATY38_03325
   00650 Butanoate metabolism
    ATY38_03325
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ATY38_03325
   00072 Synthesis and degradation of ketone bodies
    ATY38_03325
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ATY38_03325
   00310 Lysine degradation
    ATY38_03325
   00380 Tryptophan metabolism
    ATY38_03325
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ATY38_03325
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ATY38_03325
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ATY38_03325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nur04147]
    ATY38_03325
Enzymes [BR:nur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ATY38_03325
Exosome [BR:nur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ATY38_03325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALQ50350
UniProt: A0A0S3AGS5
Position
complement(686514..687716)
Genome map
AA seq 400 aa AA seqDB search
MRDVVVLSGVRTAIGDYGGSLQQIAPADLAAKVVREAVLRAKIDPNDVGHLVFGNVIPGE
SRDMYLARVACINGGLPQHTSALTVNRLCGSGLQAIISASQSIMLNDTDVAVAGGAESMS
RGGYLLPALRWGQRMNDGGAVDMMIGALTDPFDHVHMGITAENIAEKWRISRTEQDAFAM
ESHRRALSAINNGYFKEQILPVEIVVGKKTVLFDTDEHPREDTNLESLGKLRSIFKREGT
VTAGNASGINDSAAAVVLMESSVARKRGLKPMARLVAYGHAGVDPKFMGIGPVPAVQMAL
QRSNIKLAELDVIESNEAFAVQACAVAKELQFDPGKTNPNGGAVALGHPIGATGCILTIK
ALYELQRAGGRYALVTMCIGGGKGLRQSLRNMNSGVGLVV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagagatgtagtggttttaagcggggtacgaacagccataggtgattatggtggttca
ttgcaacagattgctccggctgatctggcggcaaaagtagtgcgagaagccgtattgcgg
gcaaaaattgaccctaatgatgttgggcatctggtttttggtaatgtgattcccggagaa
tcgcgcgatatgtatttagcacgtgtggcctgtatcaatggcggcttgccgcaacatact
tcggcgctgacagttaatcgtttgtgcggaagcggattgcaagccattatttcggccagc
caaagtattatgctcaatgatactgatgtggcagtcgcgggcggtgcggaatccatgagt
cgaggtggttatttattaccggcattgcgctgggggcagcgcatgaatgacggaggtgcc
gtggatatgatgatcggtgcgcttaccgatccatttgatcacgtgcatatggggatcaca
gctgaaaatattgcagaaaaatggagaattagcagaacagagcaggatgcatttgcaatg
gagagtcatcgtcgtgccttgagtgcgattaataatggctacttcaaagagcaaatattg
cctgttgaaattgttgttggtaaaaaaacagttctttttgatactgatgagcatccacgt
gaagatacgaatttagagagtttaggtaaacttcgatctatttttaaaagagagggtacg
gtaactgcaggtaatgcctccggtataaacgatagtgcagctgcagtggttttgatggag
agtagtgtggcacggaaaaggggtttaaagccaatggcgcgtttggttgcctatggtcat
gccggtgtagatccaaaatttatggggatcgggccggtgcccgctgtgcaaatggcattg
cagcgttcaaatatcaaactagcagagctggatgtgattgagtccaatgaagcatttgct
gtacaagcttgtgcggtcgcaaaggaattgcaatttgatccgggaaaaactaatccgaat
ggaggggcagtggcattaggtcacccgataggtgcaacaggttgtattttaacaatcaaa
gcgctgtatgaattgcagcgtgccggtgggcgctatgcgctggtcactatgtgcattggg
gggggcaagggattgcggcaatctttgagaaatatgaatagcggcgtaggacttgttgtt
tga

DBGET integrated database retrieval system