KEGG   Nitrosomonas ureae: ATY38_08295Help
Entry
ATY38_08295       CDS       T04188                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nur  Nitrosomonas ureae
Pathway
nur00450  Selenocompound metabolism
nur00970  Aminoacyl-tRNA biosynthesis
nur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ATY38_08295
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ATY38_08295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nur01007]
    ATY38_08295
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nur03016]
    ATY38_08295
Enzymes [BR:nur01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ATY38_08295
Amino acid related enzymes [BR:nur01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ATY38_08295
Transfer RNA biogenesis [BR:nur03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ATY38_08295
 Prokaryotic type
   Other AARSs
    ATY38_08295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ALQ51220
UniProt: A0A1H2GMC3
Position
1833309..1835414
Genome map
AA seq 701 aa AA seqDB search
MSKRKILVTSALPYANGSIHLGHLVEYIQTDIWVRFQKMRGHEVYYVCADDTHGTPIMLR
AEKEGITPEALIARVHSEHLGDFSGFHIQFDNYYSTHSAETRHFSEDIYAKLKAAGLIAV
RGIEQLYDPVRNMFLPDRFVKGECPKCGAKDQYGDSCEVCGAAYVPTELKNPYSAVSGAK
PINKSSEHYFFNLSDPRCVDFLRDWACEGNHLQLEAANKMREWVGETGENKLSDWDISRD
APYFGFEIPDAPGKYFYVWLDAPVGYMGSFKNLCERQGIQFDEFWQPQSDTELYHFIGKD
ILYFHALFWPAMLKNAGYRTPTKIFAHGFLTVNGEKMSKSRGTFITAESYLRQGLNPEWL
RYYYAAKLNSTLEDIDLNLEDFVARVNSDLIGKFINIASRCAGFISKRFDGGLVDGAQYQ
ALQQMVNKHFAAWRPDVIEQAFEAREYSAAIRQIMKFADEANEMIHQLAPWEIAKNPDRS
DDLQRTCSLGVQLFYLLSRYLKPILPATAQQIEAFLNCAPLTWPQLRDAQPVSNLLLPAG
HKINTYQHLMTRIDPKQIDALIAANTQSLAPTAQDVPIRHAEKKQHAVAPLAETISIDEF
SKIDLRIAKIVNAEHVPGAEKLLKLTLDIGSEQRVVFAGIKSAYDPQLLKGRLTVMVANL
APRQMKFGLSEGMVLAAGSGNPGELFILSPDTGAQPGMRVK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgaaaaattctggttacttctgcacttccttacgccaacggcagtatccat
ttaggtcatctggtggaatatattcaaaccgatatctgggtgcgatttcagaaaatgcgc
ggacatgaggtctattatgtgtgtgccgatgatacgcatggtacgccgattatgttgcgc
gcggaaaaagaaggcatcaccccggaagctttgatcgcgcgcgttcattcggagcactta
ggagattttagcggatttcatattcaatttgacaattattacagtacgcattcagcggaa
acacggcatttctccgaagatatctacgctaagctaaaagctgcgggtttaattgctgtg
cgtggcattgaacaactttacgatccggtcagaaatatgttcctgccggaccggtttgtc
aaaggagagtgtccgaagtgcggggcaaaagatcagtacggcgattcgtgcgaggtatgc
ggcgcggcgtatgtgccaaccgaactgaaaaatccctattccgctgtatcgggtgcaaag
ccgatcaataaatcatccgaacattatttctttaacttgtccgatcctcgttgcgttgat
tttttacgggattgggcttgtgaaggcaatcatttacagcttgaggccgccaacaaaatg
cgcgagtgggtcggagaaacaggggaaaataagctttcggattgggatatttcgcgcgat
gctccttatttcggttttgaaattcccgatgcacccggtaagtatttttatgtctggctt
gatgcaccggtgggttacatgggtagcttcaagaatttatgcgaacggcaagggattcag
ttcgatgaattttggcagccgcaatccgatacggaactgtatcacttcattggcaaggat
attttgtattttcacgcgctattttggcctgcgatgctgaaaaatgccggatatcgcaca
ccgacgaagattttcgcgcatggttttctgacggtgaatggtgaaaaaatgagcaagtcg
cgcggcacgtttatcactgcggaaagttatttgagacaaggtttgaaccccgaatggctg
cgttactactacgcagccaagctgaacagcacattggaagatatcgacttgaatctggaa
gatttcgtcgcgcgcgtcaattcagatttgattggcaagttcatcaacattgctagtcgc
tgtgcgggttttatcagcaaacgatttgatggcggattggttgatggcgcgcagtatcaa
gctctgcagcagatggtgaataagcattttgccgcatggaggccggatgttattgaacaa
gcatttgaagcgcgtgaatattctgccgctattcgccaaatcatgaaatttgctgacgaa
gcaaacgaaatgattcaccaactcgcgccatgggaaatcgccaaaaatcccgatcgtagt
gatgatttgcaacgtacttgcagtcttggcgttcaattgttttatttgctatcgcgctac
ctgaaaccgatcctgccggccactgcgcaacaaatagaagcctttcttaattgtgcacct
ttgacctggccgcagctgcgcgacgctcaaccggtttccaatctattgctgcctgcgggc
cataagatcaatacttaccagcatttgatgacacgtatcgatccaaagcaaatcgatgcg
ttaattgcagccaacacgcaaagtttggcgcctacagcgcaagatgtaccgataaggcat
gcggagaagaaacaacatgcagttgcgccacttgccgaaaccatttccatcgacgaattc
agtaaaattgatttgcgtatcgctaaaattgtcaatgcagagcacgtgccaggcgcggaa
aaattattgaagctaacgctcgatatcggcagcgagcaacgtgtggtttttgccggtatt
aaatccgcctacgatccgcaactgcttaaaggacggctgaccgtgatggttgctaatctc
gcgccacggcaaatgaaattcggtttatcggagggcatggtgttggctgcgggcagcggc
aatccaggtgagttattcattttgtcacccgataccggtgcacaacccggaatgcgggtt
aagtaa

DBGET integrated database retrieval system