KEGG   Nitrosomonas ureae: ATY38_14940Help
Entry
ATY38_14940       CDS       T04188                                 

Definition
(GenBank) sirohydrochlorin ferrochelatase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
nur  Nitrosomonas ureae
Pathway
nur00860  Porphyrin and chlorophyll metabolism
nur01100  Metabolic pathways
nur01110  Biosynthesis of secondary metabolites
nur01120  Microbial metabolism in diverse environments
Module
nur_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nur00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ATY38_14940
Enzymes [BR:nur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     ATY38_14940
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     ATY38_14940
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     ATY38_14940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M XdhC_C TrkA_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ALQ52391
UniProt: A0A1H2E1X3
Position
3238787..3240217
Genome map
AA seq 476 aa AA seqDB search
MDYLPIFLDIKNKTCLIVGGGQVATRKVMLLLQAGAQVSVVAPELESVLDEYAAHGTINH
RAKCFQPEHLHNIALVIAATNDHAINQQVSEAAQERRIPVNVVDNPALCTFIMPSIVDRS
PLLIAVSSGGQSPVLARLLRAQLETMIPVAYARIATIAGKFRKRVKQHFTHPAKRRIFWE
TILQGPFTEMILAGKDKTAQNYLLQSLQQEKNEPPQGEVYLVGAGPGNPDLLTFRAMRLM
QQADVVVYDRLVSTAILDMVRRDATRIYAGKERNRHTLKQESINQLLVRLAQEGKRVLRL
KGGDPFIFGRGGEEIETLALNHIPFQVVPGITAASGVSAYAGIPLTHRDYAQSCIFVTGH
LKNNTIDLDWPRLACPNQTIVVYMGLLGLPVLSRQLISHGLPSSMPAAIIQQGTTQQQEI
VIGTLQTLPNLAATAHLSPPTLIIVGEVVKLHKNLAWFEPALENSKTHLIDMESNG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggattacctgccaatctttttagatattaaaaacaaaacttgtctgatcgtaggtggt
ggtcaagtcgccacccgcaaggttatgctgttgctccaggccggtgcgcaagtatcagtg
gtagcacctgaactggagagtgttttagatgagtacgctgctcacggcactatcaatcat
cgggctaagtgctttcaacccgaacatctgcacaatattgccctggtaatcgctgcaaca
aatgatcatgctattaatcagcaagtttccgaagcggcgcaagagagacggattccggtt
aatgtcgttgataacccggcattatgcactttcatcatgccatccatcgtcgaccgctcc
ccactcctaatcgcggtctccagcggcgggcaatcaccggtcttggcgcgattgctgcgt
gcacaactggaaaccatgatacctgtcgcttacgcacgcatcgctaccattgcaggaaag
tttcgtaagcgcgtaaaacaacacttcacccacccggcgaaacggcgcattttctgggaa
acaatcctacaaggtccgtttactgaaatgatattggctggtaaagataaaactgctcaa
aattatttgctgcaatcgctgcaacaggaaaaaaatgaaccgccgcaaggtgaggtttac
ttggtcggtgccggaccgggtaatcctgatttactgacttttcgtgctatgcgtctgatg
cagcaggccgatgtagtcgtttatgaccgtctggtctcaactgcaattctggatatggtg
cgccgtgacgccacacgtatttacgctggcaaggaacgtaaccgccacacactgaaacag
gaatcgatcaatcaactgctggtacggttggcgcaggaaggtaaacgagtgttgcgactt
aaggggggggatccttttatttttggccggggtggtgaagaaattgaaactctggcttta
aaccatattccttttcaagttgtaccaggtattacggctgcatcgggtgtttccgcatat
gcaggaattccgctgacacaccgtgattacgcgcaatcatgcatttttgtgaccggtcat
ctaaaaaataatacgattgatctcgattggccacgcctcgcctgccccaaccagaccatt
gtggtttatatgggattgcttggattacccgtgttatcccggcaactgatctcccacggc
ttgccgagttctatgcccgcagcaatcattcaacaaggtacgacgcaacaacaagagatc
gtgatcggaaccttgcaaacactacctaacttggccgcaacggcgcatttgtcccctccc
acgctgattattgttggagaagttgtcaaactgcacaaaaatcttgcatggtttgagcca
gcacttgaaaattctaagacccatttgattgatatggaatcaaatggttaa

DBGET integrated database retrieval system