KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g10066Help
Entry
NEMVE_v1g10066    CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:nve00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    NEMVE_v1g10066
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nve03019]
    NEMVE_v1g10066
   03009 Ribosome biogenesis [BR:nve03009]
    NEMVE_v1g10066
   03036 Chromosome and associated proteins [BR:nve03036]
    NEMVE_v1g10066
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     NEMVE_v1g10066
Messenger RNA biogenesis [BR:nve03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     NEMVE_v1g10066
Ribosome biogenesis [BR:nve03009]
 Eukaryotic Type
  90S particles
   RNase
    NEMVE_v1g10066
 Prokaryotic Type
  rRNA processing factors
   NEMVE_v1g10066
Chromosome and associated proteins [BR:nve03036]
 Eukaryotic Type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     NEMVE_v1g10066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm
Motif
Other DBs
NCBI-GeneID: 5503894
NCBI-ProteinID: XP_001624846
JGI: 10066
UniProt: A7SU62
AA seq 917 aa AA seqDB search
STVTGTKKLENLYAAFEEKILQLKSSPVNMLPGHDDPAAVHSDSDKSDFESVTDFCDGDD
ESMSSDDEKHSTGPSPPQVKERKLNDPRRLHKDLWFNEKGETNEGPVCRCSVKEKMTGIR
HAVYPGEMEIPRCDLLGNNSSNLHHYWVTVTPHANFMTDRPTIIQHKGREFVFEGFSLLS
HHRLNKVPPCSLIRYNIEYEIHFIEHPVPKNFCIKGLDLFSDFLFDKVLELHDWALKGVF
SVNSDNQCPRFHFLPRFVFRRSGKVDELLSMDKVLAHLMDSYKPLIQVRTSRQYTPDWGK
LSKSCRNQIVTRPCMKPAAFRVDDIEFSSADDTRTSGVRTRYPYIIHHGIRPVQMSYVGN
PKYQKLWKSYVKLRNTLANSSTSASVKKVSSSPLPRSKSENKDSMRRDFRARLNSQGVMA
TGIHSDVCQHAMLLPVLVHHIRYHTCLRTLDAKLGYTFKDRMLLQLALSHPSYHLNYGMN
PDHARNSLSNCGVKQPRYGDRRIHNVHSKKKGITHLVRVMANLGKVEEDRSMIRHNERLE
FLGDAVLELICSKHLFFMLPDMDEGHLATFRSALVQNRHLALLAKMLDLSDYMQFSHGPD
LCQEDDLNHAMANCLEALLGAVYLEAGLQVATELFSRLAFTEQDLYDKWMELPKHRLQDQ
EPGGDRHLIGSSPVLQKLVEFEEGSGIPFTHIRLLARAFTHPQVGKNNLTLGDNQRLEFL
GDSVLQFVVSVFLYQHFPDHHEGHLTLLRSSLVNSRSQAEIARQLNLQEFINTGPTNVRE
KMLADVLEALIAAVFVDKGLRHVEVFCRVCFFSRLEDSIVNQEWIDSKSQLQQCCLAMRT
EGKSPDLPIYRILQDAGPAHHKKYQVGVYFQGTRCGKGEGSSIHQAEMAAAKDALESRYF
PEHARQKHLLDRKYKDK
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
tccactgtgactgggacaaaaaagcttgaaaacctctatgcagcatttgaggaaaagatc
ttacagctcaagtctagccctgttaatatgctgccagggcacgatgatccagcagcagta
cattctgattcggataaaagtgactttgaatcagtcacagatttctgtgatggagatgat
gagagtatgagctcagatgatgagaagcatagtactggcccatcaccaccacaagtgaaa
gaacggaagttaaacgatccaaggcgacttcacaaagacctgtggttcaacgagaaggga
gagactaatgaaggcccggtgtgtagatgtagcgtgaaggagaagatgacagggataagg
catgctgtataccctggagaaatggaaatacctagatgtgaccttcttggtaataacagc
agtaacctccaccactactgggtgactgtgactccacatgctaattttatgacagatcga
ccaacaataattcagcacaagggaagagaatttgtgtttgaaggtttttcacttctctct
catcatcgattgaacaaggtcccaccttgctcccttatccgctacaatatagaatatgag
attcactttattgaacatcctgttcctaagaatttctgcatcaaagggctagacttgttt
tcagactttttgtttgacaaagttcttgagctacatgattgggcattgaaaggtgtgttt
tctgttaattctgataatcagtgcccaaggttccactttctaccgagatttgtcttcagg
agaagtggtaaagttgatgaattgctctctatggacaaggttttggcacacttgatggat
agctacaagcctctcatccaggtaagaacttcaaggcaatacacccctgactggggaaag
ctttctaaatcctgccgcaaccagattgttactaggccctgtatgaaacctgctgctttt
cgtgtggatgatattgaattcagcagtgctgatgacaccagaacttctggggtaaggaca
cgatatccatatattatccatcatggtatccgcccagtgcagatgagctatgtgggaaat
ccaaagtaccagaagctctggaagtcgtatgttaaactgcgaaacacccttgccaacagt
tcaacgtctgcatctgtaaaaaaggtcagttcttcgcccttaccgcgttctaaaagcgaa
aataaagactctatgcgccgtgactttcgtgcaagattgaacagccaaggtgtcatggca
acagggatccactcggacgtctgtcagcatgctatgctacttccggttctagtgcaccac
atccggtatcacacctgcctcagaacgctggatgccaagcttggctacaccttcaaggac
cgaatgctgctacagctggctctgtcacacccgtcctaccacttgaactacggcatgaat
cccgaccatgctcgcaacagtctgtccaactgcggcgtcaagcagccgaggtacggcgac
cgccgcattcacaacgtccacagcaagaagaaaggtataacacatttggtccgtgtgatg
gcgaacttgggaaaggtggaggaagatagatcaatgatccgtcacaatgagcggctggag
tttcttggagacgctgtccttgaattaatctgcagcaagcatctgttctttatgctacct
gacatggatgaggggcaccttgcgacattcagatccgcccttgtgcagaaccgacacctg
gcgctcctggccaagatgctcgacctttctgactacatgcagttctcgcacggacccgac
ctgtgccaggaagacgacttgaatcatgccatggccaactgcctagaggcattgcttggt
gcagtctatttagaagctggtctacaagtagcaacagaactcttttcgagacttgcattc
acggaacaggacttgtatgacaagtggatggagctgccaaagcaccgcctacaggaccaa
gaaccaggtggtgaccgacatctgataggatcgtcaccagttcttcaaaaactggtggag
tttgaagaaggaagcggcatcccgttcactcacatccgtctactggcgcgtgccttcacc
catccgcaagtcggcaaaaataacctaacgctcggtgataaccagcgtcttgagttcctt
ggtgactccgtgctacagtttgttgtctcggtatttctctaccagcactttccagaccac
cacgaaggacacctcacgctcttacggagctcgttagtgaacagtcgcagccaagccgag
atcgctcgccagcttaacctccaagaattcatcaataccggacccacgaatgtgcgagag
aaaatgctagcagacgttcttgaagctctgattgccgccgtgttcgtggacaagggacta
agacacgtggaggttttctgccgcgtttgcttcttctccagactcgaggatagcattgtt
aaccaggagtggatcgactccaagtcacagctacagcaatgctgtctggccatgcggact
gaggggaaatccccggacctacccatatataggattctacaggacgccggtccagctcat
cacaagaagtaccaagttggcgtgtacttccagggcacgcgatgcggcaagggcgaagga
tccagcattcaccaagcagagatggccgctgctaaggatgccctggagtccaggtatttt
cctgagcatgcgcggcagaaacacctccttgaccgcaaatacaaggacaag

DBGET integrated database retrieval system