KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g104658Help
Entry
NEMVE_v1g104658   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K03505  DNA polymerase delta subunit 4
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00230  Purine metabolism
nve00240  Pyrimidine metabolism
nve01100  Metabolic pathways
nve03030  DNA replication
nve03410  Base excision repair
nve03420  Nucleotide excision repair
nve03430  Mismatch repair
nve03440  Homologous recombination
Module
nve_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NEMVE_v1g104658
   00240 Pyrimidine metabolism
    NEMVE_v1g104658
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NEMVE_v1g104658
   03410 Base excision repair
    NEMVE_v1g104658
   03420 Nucleotide excision repair
    NEMVE_v1g104658
   03430 Mismatch repair
    NEMVE_v1g104658
   03440 Homologous recombination
    NEMVE_v1g104658
DNA replication proteins [BR:nve03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    NEMVE_v1g104658
DNA repair and recombination proteins [BR:nve03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      NEMVE_v1g104658
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     NEMVE_v1g104658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 5513068
NCBI-ProteinID: XP_001633359
JGI: 104658
UniProt: A7S4K3
AA seq 78 aa AA seqDB search
MLFDTFSFQLADKDVSIDARQDDLKTLREFDLSPEFGPCLGMTRLERWERADRYGLNPPQ
DVKKILALHPTDSNYTDW
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttgatacattttcatttcaactagctgataaagatgtatcaatcgacgcaaga
caagatgacctaaagactttgagggagtttgatctttctccagagtttggaccttgctta
ggaatgacccgacttgagagatgggaaagagctgatagatatgggctgaaccctcctcag
gatgtcaagaaaatcttagccctccaccctactgatagtaactatacagattggtga

DBGET integrated database retrieval system