KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g10896Help
Entry
NEMVE_v1g10896    CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    NEMVE_v1g10896
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nve01001]
    NEMVE_v1g10896
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nve03036]
    NEMVE_v1g10896
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NEMVE_v1g10896
Protein kinases [BR:nve01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   NEMVE_v1g10896
Chromosome and associated proteins [BR:nve03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    NEMVE_v1g10896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase APH Kdo Pkinase_fungal Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 5503002
NCBI-ProteinID: XP_001624108
JGI: 10896
UniProt: A7SW88
AA seq 278 aa AA seqDB search
RHEKLENIVRDSRSPLYVDGLLDGIEALVNDCNFPQLRRNKNVENFLQRYEQPTRVIQTH
RLNNDDFKTLKVIGRGAFGEVQLVRHTHTKKVYAMKLLSKFEMIKRSDSAFFWEEREIMA
HSNSNWIVKLHYAFQDEKYLYMVMDYMSGGDLVNLMSNYEIPEKWAKFYCAEVVLALDAI
HTMGFVHRDVKPDNMLLDGEGHLKLADFGTCMRMDRDGMVRSDTAVGTPDYISPEVLKSQ
GGEGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTY
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
cggcatgaaaagctagaaaacattgtgagggattctcgaagccccctctatgttgacggc
ctattggacggcattgaagcccttgtgaatgactgcaactttccccaacttcgtcgaaac
aagaacgttgagaactttctccagcgatatgaacaaccaacgagagtgattcagacacat
cgactgaacaatgatgacttcaaaacactcaaagttatcggtcgcggtgctttcggcgag
gtccagttggttaggcacacgcacacaaaaaaggtgtatgccatgaagttgttgagtaaa
tttgagatgattaagcggtcagactctgcatttttttgggaagagagggagataatggcc
cattccaacagtaactggatagtcaagttgcactacgcattccaggatgaaaagtattta
tacatggttatggactatatgtcgggtggtgatcttgtcaacttgatgagtaattatgaa
atccctgagaaatgggcaaagttctactgtgctgaggtggtactggcactggatgccatt
cacacaatgggctttgtgcacagagatgtgaaacctgataatatgctgttagatggcgaa
gggcatctgaaactagcagactttggtacctgcatgcgaatggacagagatgggatggtg
aggtcagacacagctgtgggaacacctgattatatatcaccagaggttctgaagtcccag
ggaggggaaggctactatggacgggaatgtgactggtggagtgtcggagtcttcttatat
gaaatgcttgttggtgacactccattttacgctgattcacttgttggcacatat

DBGET integrated database retrieval system