KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g116849Help
Entry
NEMVE_v1g116849   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00230  Purine metabolism
nve00240  Pyrimidine metabolism
nve00760  Nicotinate and nicotinamide metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NEMVE_v1g116849
   00240 Pyrimidine metabolism
    NEMVE_v1g116849
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NEMVE_v1g116849
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     NEMVE_v1g116849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UMPH-1 HAD
Motif
Other DBs
NCBI-GeneID: 5508893
NCBI-ProteinID: XP_001629473
JGI: 116849
UniProt: A7SFU1
AA seq 293 aa AA seqDB search
MAPFFHQIQGLDKPSVYIIDPVGLREKLCRIYEAGPDKLQIVTDFDKTLTKFIMNGTQGC
TVHGVLETSKYFPESYREKCLALRNHYHPIELSGISPEEKGPLMVEWWTKAHDLITELNL
KKEDLPKILRDANIGLRDGVEWLFVKTYEKNVPVFILSGGLGDIIEEVIKQQSHLFDNVT
VMANYMKFNEEGVMVGLQDELISSNNKREQTRSHPYFEKHKDRTNVVVMGDLIQDTDVVG
SLKAPENVLTIGLLNEKVDERLSAYKEAFDVVVVDDHSIEVVDEVLMQLLHQQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctttttttcatcagatacaggggttggataaaccttctgtgtatatcattgat
cctgttggtcttcgtgaaaagctatgtaggatatatgaggctgggccagataagttgcag
attgtaactgattttgataagactcttacaaagttcataatgaatggaacacagggatgc
actgtacatggagttcttgaaacatcaaaatatttcccagaatcctacagagagaagtgt
ctagcattaagaaatcactaccatcctattgaattaagtggtatatctcctgaagagaaa
gggccattgatggttgaatggtggaccaaagctcatgacctaattactgaactcaatctg
aagaaagaagatcttcccaaaattcttagagatgcaaatattggattgagggatggtgtt
gaatggctttttgtcaagacatatgagaagaatgttcctgttttcattctttcaggaggt
ctaggtgacatcatagaagaggttattaagcaacagagccatttgtttgataatgtcaca
gtcatggcaaactacatgaagttcaatgaagagggtgtcatggttggattacaagatgaa
ctcatttcaagcaacaacaaaagggaacaaacaaggagtcacccctactttgagaaacac
aaggatcgcaccaatgttgttgtcatgggtgatttaatccaggatacagatgttgttggc
agtctcaaggctcctgaaaatgttcttactattggtcttctcaacgagaaggtggatgag
cgactaagtgcttacaaagaggcttttgatgtcgtggttgttgatgatcatagtattgaa
gtagtggatgaagttttgatgcaacttcttcatcaacaataa

DBGET integrated database retrieval system