KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g120073Help
Entry
NEMVE_v1g120073   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K11839  ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve04137  Mitophagy - animal
nve04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nve00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NEMVE_v1g120073
   04137 Mitophagy - animal
    NEMVE_v1g120073
Enzymes [BR:nve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NEMVE_v1g120073
Peptidases [BR:nve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NEMVE_v1g120073
Membrane trafficking [BR:nve04131]
 Endosome - Lysosome transport
  Others
   Others
    NEMVE_v1g120073
Ubiquitin system [BR:nve04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    NEMVE_v1g120073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 zf-MIZ
Motif
Other DBs
NCBI-GeneID: 5507750
NCBI-ProteinID: XP_001628364
JGI: 120073
UniProt: A7SIY1
AA seq 409 aa AA seqDB search
PATPDRLLQPTKSNLRRSLSSPNLAKLEDVPLRPEINRSAKPVEPSPVPAKPSFTRSTKP
VTLKLDSLNPIHGGLGCGLTGLRNLGNTCYMNSVLQCLFNTAPLAAYFVSGAFRDDINKE
NPLGTSGMYLDFYFITSINFSFYLTSSPEFFTTFEGVCQQDFQEFLALMMDKLHEDVCQI
RHKPYLKAPDDNIDPAEAANITWDNHRKRNESLMLNLFDGMFKSTVRCLVCAKDSVTYET
FSNLTLPLPGNSNHCSLRDCIKLFTRAERMSGDDMWYCPRCKQHRVASKQLQIWRLPPIL
IVHLKRFQYDGMWRQKLQTAVSFPVDGLDMSGYITGPTKRPAYHLYGVSNHYGTMHGGHY
TAFCKNAHNQRWFKFDDQVVTEMSANDIVSSAAYLLFYTSFEFTPPKLI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
ccagctactccagacagattattgcagcccaccaagtcaaatttgcgtcgttcattgtct
tcccccaacttggcgaagctagaagatgttccactcagacctgagattaatagatcagca
aagcctgttgagccgtcgcctgttcctgctaagccttccttcacccgcagtactaagcct
gtcactttgaagctggactcgctcaacccgattcatggaggactaggctgcggcctaact
gggctacgaaatcttggcaatacgtgctatatgaattctgttcttcagtgtttatttaat
accgcgcctttggctgcctactttgtgtcaggcgctttccgagacgacatcaacaaggaa
aaccctttgggtacctcgggtatgtatttggatttttactttattacgtcaataaacttt
tcattctacctcaccagttcaccagaattcttcactacatttgagggtgtctgccagcag
gactttcaggaattcctggcccttatgatggacaagctacatgaggatgtctgccagatt
cgacacaagccttacttgaaggctcccgatgacaacatagatccagctgaggcagcgaac
atcacgtgggataatcaccggaagcgcaacgagtctctaatgctgaacctgtttgacggc
atgttcaagtctaccgttcgctgtctcgtctgcgctaaggattccgtgacgtatgagacg
ttctcgaatctaactcttcccttgcctggaaacagtaaccactgctcgctgcgggactgc
atcaagctgttcacgcgtgccgaacgcatgtctggcgatgatatgtggtactgcccgcgg
tgtaagcagcaccgtgtagccagcaagcaactccagatctggcgacttccgccaatactt
atagtacatctgaaacggttccagtatgacgggatgtggcggcaaaagctgcagacagcg
gtatcctttcctgtcgatggcctggatatgagtggctacatcactggccccacgaagaga
cccgcctatcacctgtacggggtgtccaaccactacggtaccatgcacggtggccactac
accgccttctgtaagaacgcgcacaaccagcgatggttcaagtttgacgaccaggtcgtc
acggagatgagtgctaatgatattgtgagctcagctgcatacctcttgttctacacttca
ttcgagttcactcccccgaaactaatttaa

DBGET integrated database retrieval system