KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g130738Help
Entry
NEMVE_v1g130738   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
Organism
nve  Nematostella vectensis (sea anemone)
SSDB OrthologParalogGFIT
Motif
Pfam: GAS2 CH
Motif
Other DBs
NCBI-GeneID: 5504270
NCBI-ProteinID: XP_001625192
JGI: 130738
UniProt: A7ST60
AA seq 256 aa AA seqDB search
MEKWLIPLKEDLASWISRLLGEEELNTDTFTSMLDTGVVLCRLANFIQTVGEEFFVRNPK
FPRRGLFPACGVTYKQRGATHGSFVARDNVSNFIRWCRELRVPDVIMFETEDLVLNKNEK
TVLLTLLEVARKAFKVGVEPPELVRLENEIDQELELEPEPLQEPAPRQEVRLLKKKHKSH
SLDDLVSECSTILDKCTCPTRYPVQRIADGKYKMGDSKNLIFVRVMRKHVMVRVGGGWDT
LDRYFDKHDPCRNHGI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatggctgatacctctcaaggaagatctcgcgtcgtggatttcgcgtttactg
ggagaggaagagctaaatactgacacttttacatctatgctagatacgggtgtagtgctt
tgtaggttagcgaattttatccagacagtaggtgaggaattctttgtacgcaatccaaag
tttcctcggagaggtttatttcccgcgtgcggtgtaacatacaaacagcgcggagcaact
catggctcgtttgtcgcccgagacaacgtttctaattttatccgatggtgtcgcgaacta
agggttcccgacgttatcatgtttgaaacggaagacttggttctcaacaaaaacgagaaa
acggttttattgaccttactcgaggtagcgcgcaaagcatttaaagtcggcgtcgagccg
ccagaacttgtgcgcttagaaaatgaaatcgaccaagagttagaactggagcctgagccc
ttacaggagccagcaccgagacaagaagtgagattactcaagaaaaaacacaaatcacac
agcctggatgatttggtaagtgaatgcagtacaatcttggataaatgtacatgccccacg
cgatatcctgtacagcggatagcagatggaaaatacaagatgggtgatagcaagaatctc
atctttgtcagggtgatgcgaaaacatgtgatggtgagagttggcggaggttgggacaca
ttggaccgctatttcgacaaacacgacccgtgcagaaatcacggtatataa

DBGET integrated database retrieval system