KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g131545Help
Entry
NEMVE_v1g131545   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
Organism
nve  Nematostella vectensis (sea anemone)
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AlaDh_PNT_C F420_oxidored
Motif
Other DBs
NCBI-GeneID: 5504041
NCBI-ProteinID: XP_001624978
JGI: 131545
UniProt: A7STU2
AA seq 263 aa AA seqDB search
LITEELMASLPNLKVISNIGAGIDNIDLEAAKRRGILVGNTPGISDCLADFAWALLMAAA
RNVIQADAMMRKPGFKIPSIINWHGTRVSGATLGIIGLGNIGLAVAKRAKGFDMRILYYN
RTRKMKAESELGVHYCSGLKDLLKESDYVMLSCALTPETRHIIKSAELSQMKPSATLINV
ARGGLVNHDDLTTALQNGVIRGAALDATDPEPLPHDHPLLALSNAIVTPHIASATLHARR
AYVKNALLNVNAGLRGDPLPFPC
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
ctgatcacagaagaattgatggcatctttgcctaacttgaaagtgatttccaatattgga
gcaggaattgataacatcgacctcgaggctgccaaacgacgggggattttagtggggaat
acacctggtatttctgactgtcttgctgactttgcatgggctctgctgatggctgcagcc
aggaatgtcattcaagctgatgccatgatgagaaagccaggattcaaaataccgtcaata
atcaactggcatgggacgagagtgagtggagcgactttggggatcattggtcttggaaat
attggactagcagttgcaaagcgagccaagggctttgatatgagaatcttgtactataac
cgaacaaggaaaatgaaggctgagtctgaattaggtgtgcattactgcagtggcctaaaa
gatcttctgaaggagtcagattatgtcatgcttagctgtgccctcacaccagaaaccagg
catataatcaaatctgcagagctttcacagatgaagccatcagcaacactcatcaacgtt
gctaggggcggacttgtcaatcatgatgacttgacaacagctctgcagaatggagttatc
cgtggtgctgcacttgacgcaacagaccctgagcctctcccccatgaccaccctctactt
gcgttatctaacgcgattgtcactccacatatagccagtgcaactctccatgcacggagg
gcttatgttaagaatgcattattgaatgttaatgcagggctcaggggtgatccactgccc
ttcccatgctaa

DBGET integrated database retrieval system