KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g141884Help
Entry
NEMVE_v1g141884   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Chromosome and associated proteins [BR:nve03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    NEMVE_v1g141884
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEMVE_v1g141884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 5500882
NCBI-ProteinID: XP_001622252
JGI: 141884
UniProt: A7T1L2
AA seq 64 aa AA seqDB search
MNSFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgttcgtgaacgacatcttcgagcgcatagctggtgaagcctcccgcctggcg
cactacaacaagaagtccaccatcacgagcagggagatccagacagccgttcgtctgctt
ctccccggtgagctggccaagcacgccgtgagcgagggaaccaaggccgtcaccaagtac
accagcagcaagtaa

DBGET integrated database retrieval system