KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g159064Help
Entry
NEMVE_v1g159064   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:nve00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NEMVE_v1g159064
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nve01007]
    NEMVE_v1g159064
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nve03016]
    NEMVE_v1g159064
Enzymes [BR:nve01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     NEMVE_v1g159064
Amino acid related enzymes [BR:nve01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   NEMVE_v1g159064
Transfer RNA biogenesis [BR:nve03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    NEMVE_v1g159064
 Prokaryotic Type
    NEMVE_v1g159064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DUF4007 DALR_2 DUF445 Hormone_1
Motif
Other DBs
NCBI-GeneID: 5520941
NCBI-ProteinID: XP_001640747
JGI: 159064
UniProt: A7RID2
AA seq 634 aa AA seqDB search
MSAKNLPSWNQPQGHGELKLYNSLTREKNLFIPSNGRRVTWYSCGPTVYDASHMGHARSY
ITFDIVRRVLQSYFNYDVFCVMNVTDIDDKIIHRARRNHLQEKYREENSDPKKILSDIQV
ALQPYVKKMEDTKDEDKKNMFIKIIEKVQSTCGKLEALLQKGKADDVQAVTQELLADASD
PLSAWLDSKHGSDVTDHRIFAKLTEFWEQEYHKDMAALNVLPADILTNITEYVPEVVTFI
EKVIANGYAYESNGSVYFDTIKFGSSEKHSYARLVPEAVGDLDALAEGEGELSQNLGEKR
SERDFALWKASKPGEPSWESPWGKGRPGWHVECSVMARDGLGSKIDIPTGGVNLKFPPHD
NELAQSEAHFCVSQWVNYFLHAGHLTIEGCKMSKSLKNFITIKQALKRNSSRQIRLAFLL
HTWNATLDYSQNVIREAEQVEKLFNDFFLAVKDILRKPEVKAPGSHNYHELEKDLQSKFH
EKKDGVHQALCDSIDTPGALRHMQDLVKLSNIYISNKKQRNESANKQLLEGVAKYITQML
KIFGANEGEQLIGFGSAVQQSGGNQEEVALPYVQLLADFREDIRAIAREEKVPRILKACD
DLRDNKLVDVGVLLEDQEGDQKAVIKFVDRETLL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctaagaatctaccatcttggaatcaacctcaaggccatggtgaacttaagctt
tataatagcttgactcgagaaaagaacctgtttatcccttcaaatggccgtcgtgtcact
tggtacagttgtggaccaactgtttatgatgcgtctcatatgggtcatgctcgatcttac
atcacctttgacattgtacgcagagtgttgcagtcttacttcaactatgatgtgttttgt
gtaatgaatgtaacagacatagatgataagatcatccatagagcaagaagaaaccacctc
caggagaaatatcgagaagaaaatagtgaccctaaaaaaattctgtcagatattcaagta
gctttgcagccttatgtgaaaaagatggaggatacgaaagatgaagacaagaaaaatatg
tttattaagatcattgaaaaggtgcaatcaacatgtggaaaacttgaggcactgctacag
aaagggaaagctgatgatgttcaagctgttacacaggagctattagctgatgcatcagat
cccctgtcagcttggctagattccaagcatggctctgatgtgacagaccacagaatcttt
gccaaacttacagagttctgggaacaagaataccacaaagacatggctgctctgaatgtc
ctgcctgcagatatcctgaccaacattacagaatatgtgccagaagtggtgacctttatt
gagaaagtcatagcaaatggatatgcatatgagtctaatggctcggtttatttcgacacc
atcaaatttggatctagtgagaagcatagctacgctagacttgtgccggaggctgttggc
gacttggatgcattagcagaaggagaaggggaactgagccagaatctgggtgaaaagcgt
tctgaaagggattttgctctttggaaagcaagcaagccaggagaaccttcatgggaatct
ccctggggcaaggggagaccaggctggcatgttgagtgttctgtgatggcaagggatggt
cttggatccaaaattgatattcccaccggaggggtaaatctgaagtttcctccccacgac
aatgaattagcccaatctgaagctcatttctgtgtcagtcagtgggtcaactattttctt
catgctgggcacttgacaatagaggggtgcaaaatgtctaaatctctaaagaatttcatc
actatcaagcaagctttaaagagaaactcatcgcgtcagataaggcttgcatttctgtta
cacacatggaatgcaacactggactacagccagaatgtgatcagggaggctgaacaagtg
gaaaaactatttaatgatttttttttggctgtgaaagacattttgagaaagcctgaagtt
aaggctcctggttctcacaactaccatgagctggaaaaagaccttcagagcaagttccat
gaaaagaaagatggtgttcaccaggcactctgcgattctatcgacactcctggtgcactt
cggcacatgcaggacctggttaaactctccaacatttacatcagcaacaagaagcaaagg
aatgaatctgcaaacaagcagttgcttgagggtgttgcaaaatacatcacacagatgctc
aagatatttggagcaaacgaaggcgagcagctcattggctttggctcagcagtccagcaa
tctggaggaaatcaagaggaggtggccttgccatatgtacaactactagctgacttcagg
gaggacatcagggcaatcgcccgagaagaaaaagttccacggatcctaaaagcttgtgat
gacctgagagacaacaaattggtcgatgttggagttctgcttgaggaccaagaaggtgac
cagaaagcagttatcaagtttgttgatcgagaaaccttgctttaa

DBGET integrated database retrieval system