KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g163167Help
Entry
NEMVE_v1g163167   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00430  Taurine and hypotaurine metabolism
nve00480  Glutathione metabolism
nve00590  Arachidonic acid metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    NEMVE_v1g163167
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NEMVE_v1g163167
   00480 Glutathione metabolism
    NEMVE_v1g163167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nve01002]
    NEMVE_v1g163167
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:nve04090]
    NEMVE_v1g163167
Enzymes [BR:nve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     NEMVE_v1g163167
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     NEMVE_v1g163167
    3.4.19.14  leukotriene-C4 hydrolase
     NEMVE_v1g163167
Peptidases and inhibitors [BR:nve01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   NEMVE_v1g163167
CD molecules [BR:nve04090]
 Proteins
  NEMVE_v1g163167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 5516581
NCBI-ProteinID: XP_001636698
JGI: 163167
UniProt: A7RVG5
AA seq 566 aa AA seqDB search
MTSHTKKLPHKQHHFEHAAVAADNSRCSEIGRDVLKKQGTAVDAAIATMLCVGVINLHST
GVGGGGFMLVYNSHLKKAEMIDFRETAPLQANRDLFQGDAIKGIKGGLAVAVPGELKGME
VAWKKYGKLPWKDLFAPSIALAKEGFPLPETVSIAINIWKKYLTKDKGFRKIFMPYGKLL
KTGETVRRPNLAKVLSLIANANSSKPFYNGKLSHTIVSDVKAAGGVLTLSDLRHYKVKVK
EALKSHIGSMTLMTGPPPTSGPVLSMILNILSGYNFKSSDMKKHPVRTYHRIIEAFKFAY
KYRSMLGDPDFEKSVPGVVNDMLSEKVAKYYRHMILDNKTQTPSYYGSRYHVPVKTGTTH
ISVLSKEGDAVSVTSTVNGYFGAKFISPKLGIVYNNEMDDFSAPGITNEFGLLPAPVNFI
KPNKRPQSSAVPAIILDKFGHVNMVVGAAGGTIITTSVAQVIMNYFWFNKNLQNAITMPR
LHDQLYPDYAFAETWMPESIVNGLRALGHKVNVSDTSHGVVQGVVKIPYKYLKTDNHGKR
KGYVHRMLHQVYAESDFRKGGLPAGF
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacacaccaagaaattgccgcataagcagcatcacttcgagcacgcagcagtc
gccgctgataattcccgatgctcagaaatcgggcgtgacgttctcaagaagcaagggaca
gcggtcgatgctgccatagcaaccatgctctgtgttggcgtgatcaatctccactccaca
ggggtagggggtggaggttttatgctcgtttataactctcatctgaagaaagccgagatg
attgatttcagagagacggctcctttgcaggctaacagggacttgttccaaggcgatgcg
attaagggcatcaaaggtggtcttgcagtggctgttcccggcgagctaaagggtatggag
gtggcgtggaaaaagtacggaaagcttccatggaaggatcttttcgctccctcgattgcc
ttggccaaggagggttttcctctaccagaaactgtctccattgccattaacatatggaag
aaatacctgacaaaagataaggggttcaggaagatcttcatgccttacggcaagctcctt
aaaacaggagagaccgtcaggcgccccaatcttgccaaggttctatcgctgatcgctaat
gctaacagctccaagccgttctacaacggcaagctgagccataccatcgtgagtgacgtt
aaggcagctggaggggttctgacgctaagtgacctgaggcactacaaggtcaaggtcaag
gaggcgttgaagagtcatattggtagtatgaccctcatgacaggtcccccgccgacatct
gggcctgtgctatcaatgatcttaaacatactatcaggatacaactttaagtcatctgat
atgaagaagcacccagtgcgcacatatcacaggattatagaggccttcaagtttgcctac
aagtatcgctcgatgctcggagatccggactttgagaaaagtgtccctggggtggtaaat
gacatgctgagcgaaaaagtagcaaaatattaccgccacatgatcctggacaacaagacc
cagactccatcttactacggctcacggtaccatgtgcccgtgaagactggcactactcat
atctcggtgctgagcaaagagggagatgccgtttctgtcacgagtaccgtcaatggatat
ttcggcgccaagtttatctcgcccaagctcggtatagtctacaataatgagatggatgac
ttcagcgcgcccggaataaccaacgagttcggcttactccctgcaccagtcaacttcatc
aaaccaaacaagcgaccacaatcatctgcagtaccggcaattatactggacaagtttggt
cacgtgaacatggtcgttggggcggcaggggggaccatcattaccacatctgtggcacag
gtgatcatgaactacttctggttcaacaaaaatctccagaatgcgatcacaatgcctcgg
cttcacgatcaactctatcccgattacgcgttcgcggagacatggatgccggagagcata
gtcaacgggcttcgcgctctcggacacaaggtaaatgtgagtgacactagccacggtgtg
gtccagggcgtggtaaagatcccctacaagtacctcaagacggataaccacggcaagcgg
aaaggatatgtgcacaggatgctacatcaagtctatgccgagtcagacttccgaaaagga
gggctgccagcaggattctga

DBGET integrated database retrieval system