KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g173595Help
Entry
NEMVE_v1g173595   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
Organism
nve  Nematostella vectensis (sea anemone)
SSDB OrthologParalogGFIT
Motif
Pfam: SDF DUF5409
Motif
Other DBs
NCBI-GeneID: 5504857
NCBI-ProteinID: XP_001625720
JGI: 173595
UniProt: A7SRP9
AA seq 535 aa AA seqDB search
MAALRDCSNFSCKSCLLTIFRKFKSDLLLAFIILGAVLGFVIGAIINKPIEQILTPEDRK
TTIMLIGFPGELFMNMLKLVILPLIVASLISALACMDPKATGKIGRRVLLFYFLTTISAA
ILGLILVLAIRPGRVVKPVEKQGQPVSYRTMDSFLDLLRSLFPNNIVEACFIQYKTKYAY
DPGKYMSYNTTENITSITSRVTTTIISNGTHNITTVVKEVYPPSNLIPSGRQASSGTNVL
GIAMFCLVFGIILSRMGAKAEPLRAFFCSLNDAVMRLVMIIMWLSPIGICSIVAAKVGEM
GDIVGVLSMVGYFMLTVISSILIHGLFVLPLMYFVMTRKNPYKFMLGMGDALVTAFGISS
SSATLPTTIRCAEETGVDERIAKFVLPLGATVNMDGGALFESCVVIFIAQINGVPMEAAF
LFNTVLMAAAISVGAAGIPSAGFIYPVIVLQSVGLPVEDLALVLPIEWLLDRFRTTVNVW
GDAVGAGIVNHMSKADLVAMDALQMEQGHVSPGSPSSDHLMITHKDADDLMTTEF
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggccgctctgcgagattgctccaacttcagctgcaagtcttgcttgctgactatcttc
cgtaaattcaagagcgatctactacttgctttcataattctaggagcagttttgggcttt
gtcattggcgccataatcaacaaaccgatcgagcaaatcttgacccccgaagatcgaaag
accactataatgttgatcggatttccaggcgagctcttcatgaacatgctgaaactcgtt
atccttcctctaatagtggcaagtctgattagtgcattagcctgcatggatcccaaagcc
acggggaagattgggaggcgtgttttactgttctattttctcacgactatcagtgctgct
attttaggtctgatcttggtgcttgcaattcggcccggacgggtcgtaaaaccggtggag
aagcaagggcagccagtgagctatcgcacgatggattcattcttagacttgctaaggagc
ctattcccaaacaatattgttgaggcatgttttatacagtacaaaacaaaatatgcatat
gaccctggcaagtacatgagctacaacaccacagaaaacatcacctccatcacctctcga
gtcacaaccaccatcatcagcaatggcacccataacatcactactgtagtgaaggaggtg
tacccacccagtaatctcatcccgtctggccgtcaagcatcatctggcactaatgtgctt
ggtatcgccatgttttgcttggtgtttggaatcatactaagccgtatgggggccaaggca
gagccactaagagcttttttctgctcactcaatgatgctgttatgagacttgtaatgatc
atcatgtggctctctcccattggcatctgtagtattgtggcagccaaggtcggcgagatg
ggggatattgtgggtgtgctctcgatggttggttacttcatgctgacagtgatcagttcc
atcctgattcatggtttatttgtgctcccgcttatgtacttcgtgatgacgagaaagaac
ccttacaagttcatgcttggtatgggggatgctctcgtcacagcctttggtatttcctct
agctcagctacattgcctacaacgatccgatgtgccgaggaaacgggagtagatgagcgc
atagcgaaatttgtgctaccgctgggtgcaactgtcaacatggatggaggcgctctcttt
gaatcgtgtgtggtgattttcatcgcgcagatcaatggagtacctatggaagcggcattt
ctcttcaacactgtgttgatggcggccgctatctctgttggtgccgcaggtatcccatcc
gctggttttatctaccctgttattgtattacaatctgttggtctccctgtggaggactta
gctcttgtcctgcccattgaatggcttctggaccggttccgtacgacagtaaatgtgtgg
ggcgatgcagtaggagcaggaatagtgaaccacatgtctaaagcagatctggtcgccatg
gatgccctccaaatggaacaagggcacgtctcccctggctcaccaagctcagatcacctc
atgatcacgcacaaagatgcggatgatctgatgacgacagaattttga

DBGET integrated database retrieval system