KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g182198Help
Entry
NEMVE_v1g182198   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K07374  tubulin alpha
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve04145  Phagosome
Brite
KEGG Orthology (KO) [BR:nve00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    NEMVE_v1g182198
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nve03019]
    NEMVE_v1g182198
   03036 Chromosome and associated proteins [BR:nve03036]
    NEMVE_v1g182198
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nve04812]
    NEMVE_v1g182198
   04147 Exosome [BR:nve04147]
    NEMVE_v1g182198
Messenger RNA biogenesis [BR:nve03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     NEMVE_v1g182198
Chromosome and associated proteins [BR:nve03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     NEMVE_v1g182198
Cytoskeleton proteins [BR:nve04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    NEMVE_v1g182198
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEMVE_v1g182198
  Exosomal proteins of other body fluids (saliva and urine)
   NEMVE_v1g182198
  Exosomal proteins of colorectal cancer cells
   NEMVE_v1g182198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 5516770
NCBI-ProteinID: XP_001636866
JGI: 182198
UniProt: A7RUT0
AA seq 452 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIIDLVLD
RIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSVEGEGEEEEGEEY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagtgcatctctatccacgttggacaagccggtgtgcagattgggaacgcttgt
tgggagttgtactgcctcgaacacggaattcagcccgatggccagatgccgagcgacaag
acgatcggtggaggcgatgactccttcaacactttcttcagcgagaccggtgctggaaaa
cacgtccctagagctgtgtttgtcgacttagagccaacagtagtagatgaggttcgtacc
ggaacctaccgccagctcttccatcctgaacaacttatcactggcaaagaggatgctgcc
aacaattacgctcgtggacattacaccgttgggaaggaaatcattgatttagttctggac
agaattaggaaactggctgatcaatgtactggtttacaaggtttcctgatctttcattcc
ttcggcggtggaacggggtctggattcacctcactgctgatggagcgactgtctgttgac
tatggcaagaagtctaaattggagtttgccatttacccagctcctcaggtctctactgct
gttgtcgagccctacaactctatcctgaccacccacaccaccctagagcactctgactgc
gccttcatggtggacaatgaggccatctacgacatctgccgccgcaacctggacattgaa
agacccacctacaccaacctgaaccgtctgattggtcagattgtgtcctccatcaccgcc
tcgctgcgctttgatggtgccttgaacgtggatctcaccgagttccagacaaacttggtg
ccgtaccctcgtatccacttccccctggctacatatgccccagtcatctctgctgaaaag
gcctatcacgagcaactgagcgttgctgagatcaccaatgcctgctttgagcctgccaat
cagatggtgaagtgtgacccacgtcacggcaagtacatggcctgctgtatgctttaccgt
ggtgatgttgtccccaaggatgtcaatgctgctatcgccaccatcaagaccaagagaacc
atccagttcgtcgactggtgtcccactgggtttaaagttggtatcaactaccaaccgccc
actgttgtccctggcggtgacctggccaaggtgcagcgtgccgtgtgcatgttaagcaac
accacagctatcgccgaggcctgggctcgtctggatcacaagtttgatctaatgtacgcc
aagcgcgcgtttgtccactggtatgtgggtgagggtatggaggaaggagagttctccgag
gctcgtgaggatttggcagcccttgagaaggattacgaggaggtcggtgttgatagtgtt
gagggagaaggcgaagaggaagaaggggaagagtactaa

DBGET integrated database retrieval system