KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g185114Help
Entry
NEMVE_v1g185114   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00049  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00260  Glycine, serine and threonine metabolism
nve00620  Pyruvate metabolism
nve00630  Glyoxylate and dicarboxylate metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NEMVE_v1g185114
   00630 Glyoxylate and dicarboxylate metabolism
    NEMVE_v1g185114
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NEMVE_v1g185114
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     NEMVE_v1g185114
    1.1.1.81  hydroxypyruvate reductase
     NEMVE_v1g185114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AdoHcyase_NAD NAD_binding_7 ThiF
Motif
Other DBs
NCBI-GeneID: 5513656
NCBI-ProteinID: XP_001633867
JGI: 185114
UniProt: A7S382
AA seq 323 aa AA seqDB search
MVFQVLVTRRVPDEAIQLLKDANCQLDYWESDEPIPRNELLNRVKGKHAIFCLLTEKIDA
EVLDACGPQLKVVATMSVGYDHVNTKEIEKRGLQLGFTPGVLTDATATLNVALLLAVSRR
IVEAAAEAKNGGWGTWKPMWMTGATLKGSTVGVVGFGRIGIAVCERLAPFGVCKFLYNDI
APREDVSKHLDAKFVDKDTLYAESDFIIACTVLNEETKGMFNKQVFSKMKKNAIFVNASR
GGVVNQEDLYEALKNGEIRGAGLDVTVPEPIPLDHPLLTLKNCVVLPHIGSAEDATRTEM
ATLTSRNILAGLKGDKLPAAAKL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtcttccaagttcttgtgactcgacgtgttccagatgaagccattcaactgctaaag
gatgccaattgtcaattggactattgggagtcagatgagccaatccctagaaatgaactc
ctaaacagggtcaagggaaagcatgcaattttctgcctccttactgagaagattgatgca
gaggttttagatgcctgcggtcctcagctaaaagtggtggcaacaatgtcagtgggatat
gatcatgtcaatacaaaggaaattgaaaaacgaggattgcaacttggtttcactccaggg
gtgttgacagatgcaactgcaaccctaaatgttgctcttctattggcagtctcaagaagg
attgttgaagctgctgcagaagcaaaaaatggtggttggggtacttggaagccaatgtgg
atgactggggctaccctgaaaggcagtactgtcggtgttgttggttttgggagaatcgga
atagcagtgtgtgaacgtttagctccattcggcgtctgcaagttcctgtataatgatata
gcaccaagggaagatgtttcaaaacatctggatgcaaaatttgttgacaaggacacgctt
tatgcagagtcggacttcattattgcctgcacagttctgaatgaggaaacaaaaggaatg
ttcaacaagcaagtgttctctaagatgaagaaaaatgcgatttttgtcaatgcaagcaga
ggtggtgttgttaaccaagaagatctctatgaagcattgaaaaatggcgaaattaggggt
gctggtcttgatgtaactgtaccggagccgatccctctcgatcatccactgctgactctt
aagaactgtgttgttctccctcatatcggtagcgcggaggatgccacccgcacggaaatg
gccaccctgacttcgcgtaacattttggcggggctcaagggtgacaaactccctgctgcg
gcaaagttatag

DBGET integrated database retrieval system