KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g185918Help
Entry
NEMVE_v1g185918   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00564  Glycerophospholipid metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NEMVE_v1g185918
Enzymes [BR:nve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     NEMVE_v1g185918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 5512740
NCBI-ProteinID: XP_001633045
JGI: 185918
UniProt: A7S5I9
AA seq 483 aa AA seqDB search
MSASKKARMEENGFGNNENVVVVSDRNTQRSDNGDESGSTVWNDLTSEEIMAARKRHIGK
SCKVHFPQNPIKLAYSKGQYFYDDKGRQLLDCMNNVTHVGHCHPHVVKACSDQMAVLNTN
SRFLYSNMVQYTRRLLAKFPPSLSVCYYVCSGSEANDLALRLARTHTKQHDMVILDRAYH
GHTSALIDISPYKFNAPGGEGKKDFIHVAPCPDPYRGRHKGYGPETGIKYANEVKQLIEE
VEKDGRKIAGFICESMQGCGGQIVYPQNFMKEAFKHVRAAGGVCIADEVQVGFGRVGNHF
WAFETQDVVPDIVTLGKPIGNGHPLACVVTTPEISESFAATGMAYFNTYGGNPVSCAVGN
AVLDVIEEEGLQQHALKVGTQLIDKLKGLQQKHPLIGDVRGMGLFVGVELVKDQDTLEPA
TSEASHVVYQAKENHILISADGIHSNVLKIKPPMCFSHSDADNLVNTLDIILTEMEEGTK
EFS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgtcgaagaaagctcgaatggaggagaatggtttcggaaataatgaaaatgtc
gttgttgttagcgatagaaatactcaacgctcagataatggagacgagagtggctctacg
gtatggaatgacctaacttctgaggaaatcatggcagctcgaaaaagacatataggaaaa
tcatgcaaggtgcattttccacaaaatccaataaagcttgcctatagcaaagggcagtat
ttctatgatgacaaaggaaggcagttgctggattgtatgaacaatgtcactcatgttggc
cattgtcatccacatgttgttaaggcatgtagcgaccagatggctgtcctaaacaccaat
agcagatttctatacagcaacatggttcagtacacaagaagactgctggcaaaattcccc
ccttcactatcagtttgctattatgtctgttcaggttctgaggcaaatgatcttgcttta
agactagcaaggacgcatacaaagcaacatgatatggtcattcttgacagggcgtatcat
gggcacacctctgctctgattgatatcagcccatataaattcaatgcacctggtggtgag
ggtaaaaaagactttatccatgtcgcaccatgtcctgatccatataggggcaggcataag
ggctatggtccagagacgggaataaagtatgcaaatgaggtcaaacaacttattgaggag
gtcgagaaggatggtcggaagattgcaggttttatttgtgaatccatgcaaggttgtgga
ggacagatagtgtatccccagaactttatgaaggaagcattcaagcatgtgcgagctgca
ggtggcgtgtgtatcgctgatgaggtgcaagttgggtttggccgtgttgggaatcatttc
tgggcatttgagacacaagatgtggttccagatattgtgacactcggcaaacctattggt
aatggccatccattagcatgtgttgtcaccacaccagagatctcagagagttttgctgca
actggaatggcctactttaacacttatggtggtaaccctgtatcatgtgcagttggcaac
gccgtcttagatgttatagaagaagagggtcttcaacagcatgcactcaaagtgggaact
cagcttatagacaagctgaaagggttacagcagaaacatcccctcataggagatgtcagg
gggatggggctatttgttggtgtggaactagtgaaagatcaggatacattagaacctgct
acctctgaagcttcacacgttgtataccaagcaaaagagaatcatatactcatcagcgca
gatggaatccattcaaatgtactgaaaatcaaacctccaatgtgcttctcacatagcgat
gctgacaatttggttaataccctagatataatattgacagaaatggaggaagggacaaag
gaatttagctga

DBGET integrated database retrieval system