KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g189645Help
Entry
NEMVE_v1g189645   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NEMVE_v1g189645
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     NEMVE_v1g189645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Lycopene_cycl Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 5508664
NCBI-ProteinID: XP_001629237
JGI: 189645
UniProt: A7SGL6
AA seq 438 aa AA seqDB search
MNHVSDIFLNSGKVRMRRRKYGNYLLEERLVILGTGWASYSVLKHVDKKLFDVFVISPRN
HFLFTPLLCSTTVGTLEFRSIIEPVRNTGFRDEHHFQVAEAVKLNVDSHSIQCKSTLNGQ
LFDIIYDKLVIGVGAVSNTFGVPGVYEHAYFLKELADARKIRNQILKNFELAMQPGVSEA
EKKRLLHFVIVGGGPTGVEFGAELYDFMKQDVTRLYPHERGEVRVTLIEARQILPSFDEK
LRRFAEKKMRQRDQFKLLQHSVTKVNKDSIILEDGSEIPCGLVVWSTGLAPRSFTASLDL
PKNKAQQLLVDDHLRVKNIPDNTIFAIGDCSSIETAPHPCTAQVAERQGLYLANSLGLYS
QGKGSDVKPFSWKNMGMLAYLGDYQGLAELPAGKLQGFKSWILWRSVYLTKLGNWRARFQ
VPFDWARTFVFGRDVSQF
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatgtttccgatattttcctgaactctgggaaagttaggatgcggagacgcaag
tacggaaactatttactggaagaaaggctagttattctaggaaccggatgggcaagctac
agtgtactgaaacatgttgacaagaaactcttcgatgtttttgtaatcagcccgcgcaat
cactttctatttacgcctctcctttgcagcactactgttgggactttggagtttcgtagc
attatagaacccgtaagaaatacgggttttcgcgatgaacatcatttccaggtcgctgaa
gctgtgaaattaaacgttgattcccatagtatccagtgtaaaagcactttgaacggtcag
ctgttcgatatcatctatgataagctagtgattggcgtaggcgctgttagcaacacgttt
ggagttccaggcgtatatgagcatgcatacttcctcaaagaacttgcagatgctagaaaa
atcagaaatcagattttgaaaaactttgagttagctatgcagcccggagtctctgaggca
gagaaaaaacgtctgctgcattttgtgattgtgggagggggtcccacaggggtcgaattt
ggggcagagctctatgactttatgaagcaagatgtcacacgcctatacccccatgagcgg
ggtgaagttagagttaccttgattgaggccagacagattttgccctcatttgatgagaaa
ctcaggaggtttgcagagaaaaagatgcgccagcgggatcagtttaaattactccagcac
agtgtcacaaaagtgaataaagacagcattatcctggaagatggcagtgaaataccatgt
gggctggttgtatggtcaactggtcttgccccaagatcgtttactgcctctcttgatctt
cccaagaacaaggcacaacagctgcttgtagatgatcacctcagagtaaaaaacatccct
gataacactatctttgcgattggtgattgctcaagcatagagactgcacctcacccatgc
actgcacaggtagcagaacgccaagggctctatttagccaattctcttggcctgtactcc
caagggaaaggttccgatgtcaagcccttctcatggaaaaatatgggtatgttggcatac
ttaggagactatcagggactcgcggaactgcctgcgggaaagcttcagggattcaagtca
tggatcctgtggaggtcagtttatctcactaagctaggtaactggagagcacgtttccag
gttccatttgattgggcaagaacttttgtgtttggtcgagatgtgtctcaattctaa

DBGET integrated database retrieval system