KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g195499Help
Entry
NEMVE_v1g195499   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K20003  palmitoyltransferase ZDHHC4 [EC:2.3.1.225]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nve04131]
    NEMVE_v1g195499
Enzymes [BR:nve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     NEMVE_v1g195499
Membrane trafficking [BR:nve04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    NEMVE_v1g195499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 5500830
NCBI-ProteinID: XP_001622209
JGI: 195499
UniProt: A7T1Q5
AA seq 299 aa AA seqDB search
MDFLTLAFAYTACFTVICYVLLCGGSSFHRGGVISWIRRKILYGYLLVEGACINCLPTFI
TRGTSRIVDFVFYTRNHFLQAFYLFLVIGGSLVYSLHILPYFDKMNSFAYSTYCLIIINI
SFFVICCYAEPGVVTPSNMAASIQRYKYDGYYYIRKECPTCELDKPARSKHCSLCKACIN
RFDHHCSWVNNCIGANNYGFFIGFIFTAAALCIYVTFLVMIVFVYISITQRLLEGQYVDS
EGNEYSITIRHVVQFLLVNFPAIFTLFMVVLIFGIFLTLFTIFHFYLLLTNQTTNELFK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggattttcttacgctagctttcgcctacacggcttgtttcaccgtaatttgctatgta
ttgctttgtggagggagttcttttcaccgcggaggtgtaatatcgtggatcaggaggaaa
atactctatggctatttattggtagagggggcatgtatcaactgccttcctaccttcatc
accagaggtaccagcagaattgttgactttgttttctataccaggaaccactttttacag
gcattttatctgttcctcgtgatcggaggtagcctcgtttactctcttcacattctccct
tactttgacaagatgaactcgtttgcgtactcaacctactgcttgataatcatcaacatc
tccttctttgtcatctgctgttacgctgaacctggggtagtcacaccgagtaacatggca
gcatcaatccagagatacaaatatgatggatattactatatccggaaggagtgtccaact
tgtgaactagataagcctgcaaggtctaagcactgttctctgtgcaaagcatgcattaac
aggttcgaccaccactgctcatgggtgaataactgcatcggcgccaataactatggattt
ttcatcgggttcatctttacagctgcagcattgtgcatctatgtgaccttccttgtcatg
atagtgtttgtgtatatcagcataactcagcgcctactagaggggcaatatgtggacagt
gaaggcaatgagtactctatcaccatcagacatgttgtccagtttcttctcgtcaacttc
cctgcgatctttactctcttcatggtcgtcctcatctttggcatattcctgactctattc
accatattccatttctatcttctgctcacaaaccaaaccacaaatgaactcttcaag

DBGET integrated database retrieval system