KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g195674Help
Entry
NEMVE_v1g195674   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00561  Glycerolipid metabolism
nve01100  Metabolic pathways
Module
nve_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    NEMVE_v1g195674
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nve01002]
    NEMVE_v1g195674
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     NEMVE_v1g195674
Peptidases [BR:nve01002]
 Serine Peptidases
  Family S33
   NEMVE_v1g195674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DLH Thioesterase Peptidase_S15 Esterase LIDHydrolase DUF2920 Lipase_3 Chlorophyllase2 Abhydrolase_2 DUF2974 Abhydrolase_5 PGAP1 Ser_hydrolase Tannase Abhydrolase_8 UPF0227 CbiK
Motif
Other DBs
NCBI-GeneID: 5500018
NCBI-ProteinID: XP_001621535
JGI: 195674
UniProt: A7T3M9
AA seq 298 aa AA seqDB search
MANNLDSPQIIVQAPVMENEGSFKNKDGLSISTRTWTSQSEQPKALIFICHGYGDHSKRY
SKFLAQALVDEGFFVLSHDHVGHGKSEGERAQIDSLQKYVRDIFDHIDQIIPKYEGLPIY
LFGHSMGGLIAVLAAQRRPTFFKGVVLSAPALIVDPHKDNKCMRFLGKMVSWVAPSLQLL
PAMDPNSMSRDPEQVKAYAEDPLVWHGGVKVGIGLAIAHAVDEVQASMESIKWPFLVLHG
TADTLCLMEGSKQLERRAGSKDKTIKTYDGYYHDLLKEPKDDSTVILKDIIEWLNARM
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataatttggatagtcctcaaataatagttcaggcgcctgtaatggaaaacgag
ggatcgttcaaaaacaaagatggactatcgatatcaacaaggacgtggacgtctcaaagt
gagcagccaaaggctttaattttcatatgtcatggatatggggatcacagcaagcgatac
agcaagttccttgctcaagcattggtagatgaaggcttttttgttttatcccatgatcac
gttggacatggaaagagtgagggagaaagggcccagatagactcactgcaaaaatatgtc
agggatatttttgatcatattgatcaaatcattccaaaatatgaggggttacctatttac
ttatttggccattcaatgggtggcctcattgctgtgcttgcagctcagcgaagaccaaca
ttcttcaagggagtagttcttagtgctccagctctcatagtggaccctcacaaagacaac
aaatgcatgagatttttggggaagatggtctcctgggtggcgcctagtcttcagctgctt
ccagcaatggaccccaattcaatgagtagagatccagagcaggtaaaagcatatgcagaa
gacccattagtttggcatggtggagtcaaggttggcattggcttagcaatagcacatgca
gtagatgaggtacaagccagcatggagagtatcaagtggcccttcttggtcttgcatggc
acagctgatacactatgtttgatggagggatcaaaacaactcgaaagacgagccggcagc
aaagataagactatcaagacttatgatggttactaccatgacctcctcaaggaaccaaag
gatgattcaactgtgatccttaaagacatcatagaatggctcaacgccagaatgtga

DBGET integrated database retrieval system