KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g195888Help
Entry
NEMVE_v1g195888   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K17095  annexin A7/11
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEMVE_v1g195888
  Exosomal proteins of other body fluids (saliva and urine)
   NEMVE_v1g195888
  Exosomal proteins of colorectal cancer cells
   NEMVE_v1g195888
  Exosomal proteins of bladder cancer cells
   NEMVE_v1g195888
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin DNA_primase_S
Motif
Other DBs
NCBI-GeneID: 5498882
NCBI-ProteinID: XP_001620544
JGI: 195888
UniProt: A7T6G0
AA seq 292 aa AA seqDB search
MRGMGTNEAELIGILANRSNAQRVEIRKRYKTMYGKDLMNDLKSELSGNLEECLLAMMEP
SVLYDAKCLRRGMRGAGTDEETLIDILCTRSNQEIEAIKREYKEYYKRDLEKDCVSETSG
HFKRLLVSMCQGNRDTNMTVDMAKATKEAQDLYKAGEKKWGTDESRFNVVLASRSFPQLQ
ATFNEYIKISQRDIMNSIDREMSGDLKAGFRCIVQCARNPAEYFADRLWKSMKGAGTDDS
LLIRVVVSRSEVDLVEIKASFLQKYHKTVYKMIEGDCSGDYKKLLMALVGKN
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggaatgggtacaaatgaggcagagctgattggcattctagcaaaccgctccaat
gcccagcgtgtggagatcagaaagcgctacaagaccatgtatggtaaagacctgatgaac
gacctgaagtcagagctcagtggcaacctggaggagtgcctgctagcaatgatggagccg
tctgtcctgtacgatgccaagtgccttcgcaggggtatgaggggggcgggtacagatgaa
gagacactcatcgatatcctctgcacaagatccaaccaggaaattgaagccatcaaacgc
gaatacaaagaatattacaagagagacctggagaaggactgtgtgagcgagacaagcggt
cacttcaagcgccttcttgtatcaatgtgccagggtaaccgggataccaatatgactgtt
gacatggcaaaggcaacaaaagaagcccaagatttgtataaggccggggagaagaagtgg
ggaacggatgagtctcgtttcaatgtggtgctagccagcagaagtttccctcagctgcaa
gcgacttttaatgagtacatcaagatctctcagcgagacatcatgaatagtattgaccgc
gagatgtctggagatctgaaggcgggcttcaggtgtattgttcagtgcgcgcgcaacccc
gccgagtactttgccgaccgcctttggaagagcatgaagggtgctggcaccgacgactcg
cttctcatacgtgtagtggtctcacgttcagaggttgaccttgtcgagatcaaggcctcg
tttctgcagaaataccacaagacggtttacaagatgatcgagggggactgtagcggtgac
tacaagaaactgcttatggctcttgtaggaaagaattga

DBGET integrated database retrieval system